UniGene Name: sp_v3.0_unigene133867
Length: 163 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene133867
A |
Ace file of the UniGene sp_v3.0_unigene133867 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Acetyl-CoA acyltransferase (3-ketoacyl-coa thiolase) n=2 Tax=Cucurbitaceae RepID=Q08375_CUCSA | - | - | 2.0e-17 | 93% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Sma3 | 3-ketoacyl-CoA thiolase | - | - | 1.188e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Acetyl-CoA C-acyltransferase. | EC:2.3.1.16 | - | 2.036e-39 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid elongation in mitochondria | 00062 | 2.036e-39 | % | |
Sma3 | Fatty acid metabolism | 00071 | 2.036e-39 | % | |
Sma3 | Valine, leucine and isoleucine degradation | 00280 | 2.036e-39 | % | |
Sma3 | Geraniol degradation | 00281 | 2.036e-39 | % | |
Sma3 | Benzoate degradation | 00362 | 2.036e-39 | % | |
Sma3 | alpha-Linolenic acid metabolism | 00592 | 2.036e-39 | % | |
Sma3 | Ethylbenzene degradation | 00642 | 2.036e-39 | % | |
Sma3 | Biosynthesis of unsaturated fatty acids | 01040 | 2.036e-39 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 2.036e-39 | % | |
Sma3 | Metabolic pathways | 01100 | 2.036e-39 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.036e-39 | % |
Source | Gene names |
---|---|
Sma3 | ATO1; At1g04710; At2g33150; At5g48880; CHLREDRAFT_138637; DY1A; F25I18.11; GSVIVT00001258001; GSVIVT00020472001; K24G6.22; KAT1; KAT2; KAT5; KCT1; KCT2; LOC_Os10g31950; MICPUCDRAFT_44754; MICPUN_105088; OJ1136_C12.17; OSJNBb0011A08.2; OSTLU_40909; Os02g08 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | glyoxysome | GO:0009514 | Cellular Component | 0.0 | - |
Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
Sma3 | dynein complex | GO:0030286 | Cellular Component | 0.0 | - |
Sma3 | microtubule motor activity | GO:0003777 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | acetyl-CoA C-acyltransferase activity | GO:0003988 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Thiolase | IPR002155 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Dynein heavy chain | IPR004273 | - | 0.0 | - |
Sma3 | ATPase, dynein-related, AAA domain | IPR011704 | - | 0.0 | - |
Sma3 | Dynein heavy chain, domain-1 | IPR013594 | - | 0.0 | - |
Sma3 | Dynein heavy chain, domain-2 | IPR013602 | - | 0.0 | - |
Sma3 | Thiolase-like, subgroup | IPR016038 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G48880.2 | PKT2, KAT5 peroxisomal 3-keto-acyl-CoA thiolase 2 chr5:19814576-19817021 REVERSE LENGTH=457 | 2.0e-23 | 93% |
RefSeq | Arabidopsis thaliana | NP_851157.1 | 3-ketoacyl-CoA thiolase 5 [Arabidopsis thaliana] | 1.0e-23 | 93% |
RefSeq | Populus trichocarpa | XP_002299284.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 91% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMA1
Fln msg: Distance to subject end: 23 aas, your sequence is shorter than subject: 54 - 462
Fln protein:
G
Protein Length:
55
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c89586___GAIALGHPLGATGARCVATLLHEMKRRGKDCRFGVVNSMCIGTGMG
B8LMA1________________GAIALGHPLGATGARCVATLLHEMKRRGKDCRFGVI-SMCIGTGMG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain