|
||||||
|
UniGene Name: sp_v3.0_unigene133702
Length: 216 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene133702
A |
|
Ace file of the UniGene sp_v3.0_unigene133702 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | NAC domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9SZU8_RICCO | - | - | 9.0e-29 | 85% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
| Sma3 | NAC domain protein, IPR003441 | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g10350; AT4g36160; At1g12260; At1g32770; At1g33280; At1g71930; At1g79580; At2g18060; At2g46770; At3g61910; At4g10350; At4g28530; At4g36160; At5g39610; At5g62380; At5g66300; B0518A01.4; B1153E06.1; CUC3; EMB2301; EMB2749; F17M19.8; F19D11.5; F21F14.80; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
| Sma3 | specific transcriptional repressor activity | GO:0016566 | Molecular Function | 0.0 | - |
| Sma3 | transcription regulator activity | GO:0030528 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
| Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
| Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
| Sma3 | anther dehiscence | GO:0009901 | Biological Process | 0.0 | - |
| Sma3 | fruit dehiscence | GO:0010047 | Biological Process | 0.0 | - |
| Sma3 | xylem development | GO:0010089 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK | IPR000550 | - | 0.0 | - |
| Sma3 | No apical meristem (NAM) protein | IPR003441 | - | 0.0 | - |
| Sma3 | Cytochrome c oxidase biogenesis protein Cmc1-like | IPR013892 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 9, active site | IPR018221 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G18060.1 | VND1, ANAC037 vascular related NAC-domain protein 1 chr2:7848399-7850303 REVERSE LENGTH=365 | 2.0e-36 | 85% |
| RefSeq | Arabidopsis thaliana | NP_179397.1 | vascular related NAC-domain protein 1 [Arabidopsis thaliana] | 3.0e-36 | 85% |
| RefSeq | Populus trichocarpa | XP_002310297.1 | NAC domain protein, IPR003441 [Populus trichocarpa] | 2.0e-34 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLZ9
Fln msg: Distance to subject end: 216 aas, your sequence is shorter than subject: 72 - 392
Fln protein:
N
Protein Length:
73
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c89279___DKAIYAKLKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLETNENAPP------QEEGWVVCRAFKKRS
B8LLZ9________________DKAIHTNLKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLDDAEYPQANTFNELQEDGWVVCRVFKKRN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
