UniGene Name: sp_v3.0_unigene133650
Length: 146 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene133650
A |
Ace file of the UniGene sp_v3.0_unigene133650 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RecName: Full=Digalactosyldiacylglycerol synthase 2, chloroplastic gb|AAT67423.1| digalactosyldiacylglycerol synthase 2 [Lotus japonicus] | - | - | 6.0e-18 | 85% |
| FL-Next | sp=Digalactosyldiacylglycerol synthase 2, chloroplastic; Lotus japonicus (Lotus corniculatus var. japonicus). | - | - | 0.0 | 85% |
| Sma3 | Digalactosyldiacylglycerol synthase 2, chloroplastic | - | - | 2.106e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Digalactosyldiacylglycerol synthase. | EC:2.4.1.241 | - | 4.283e-24 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycerolipid metabolism | 00561 | 4.283e-24 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.283e-24 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g11670; At4g00550; CHLREDRAFT_196553; DGD1; DGD2; F6N23.24; GSVIVT00026761001; GSVIVT00038899001; LOC_Os03g11560; LOC_Os03g16140; LOC_Os11g05990; MICPUCDRAFT_20694; MICPUCDRAFT_46248; MICPUN_83849; MtrDRAFT_AC155886g14v2; OJ991214_12.18; OJA1364E02.10; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | plastid outer membrane | GO:0009527 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast outer membrane | GO:0009707 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
| Sma3 | digalactosyldiacylglycerol synthase activity | GO:0046481 | Molecular Function | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | glycolipid biosynthetic process | GO:0009247 | Biological Process | 0.0 | - |
| Sma3 | nodulation | GO:0009877 | Biological Process | 0.0 | - |
| Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
| Sma3 | galactolipid biosynthetic process | GO:0019375 | Biological Process | 0.0 | - |
| Sma3 | photosystem I stabilization | GO:0042550 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Glycosyl transferase, family 1 | IPR001296 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G00550.1 | DGD2 digalactosyl diacylglycerol deficient 2 chr4:238154-240019 REVERSE LENGTH=473 | 2.0e-23 | 82% |
| RefSeq | Arabidopsis thaliana | NP_191964.2 | digalactosyldiacylglycerol synthase 2 [Arabidopsis thaliana] | 2.0e-23 | 82% |
| RefSeq | Populus trichocarpa | XP_002308321.1 | predicted protein [Populus trichocarpa] | 3.0e-23 | 76% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q6DW73
Fln msg: Distance to subject end: 304 aas, your sequence is shorter than subject: 48 - 463
Fln protein:
C
Protein Length:
49
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c89190___PDKEAGIAVLEEPEHLTWYHHGKRWTKKFQYVIGIVHTNYLEYVKRE
Q6DW73________________PDKEADIAVLEEPEHLTWFHHGKRWKTKFRLVIGIIHTNYLEYVKRE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)