UniGene Name: sp_v3.0_unigene133604
Length: 238 nt
UniGene Fasta |
---|
>sp_v3.0_unigene133604
A |
Ace file of the UniGene sp_v3.0_unigene133604 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Triosephosphate isomerase n=2 Tax=Picea sitchensis RepID=A9NUV2_PICSI | - | - | 5.0e-35 | 93% |
FL-Next | sp=Triosephosphate isomerase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
Sma3 | Triosephosphate isomerase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Triose-phosphate isomerase. | EC:5.3.1.1 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
Sma3 | Fructose and mannose metabolism | 00051 | 0.0 | % | |
Sma3 | Inositol phosphate metabolism | 00562 | 0.0 | % | |
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At2g21170; At3g55440; CHLREDRAFT_26265; CTIMC; F26H11.7; GSVIVT00018496001; GSVIVT00024314001; GSVIVT00036055001; MICPUCDRAFT_34435; MICPUCDRAFT_46562; MICPUN_64258; MICPUN_86041; OJ1112_E07.32-1; OSTLU_24989; OSTLU_36521; OSTLU_43602; Os01g0147900; Os01g |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | GO:0004365 | Molecular Function | 0.0 | - |
Sma3 | triose-phosphate isomerase activity | GO:0004807 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
Sma3 | glucose metabolic process | GO:0006006 | Biological Process | 0.0 | - |
Sma3 | gluconeogenesis | GO:0006094 | Biological Process | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | pentose-phosphate shunt | GO:0006098 | Biological Process | 0.0 | - |
Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000173 | - | 0.0 | - | |
Sma3 | Triosephosphate isomerase | IPR000652 | - | 0.0 | - |
Sma3 | Glyceraldehyde-3-phosphate dehydrogenase, type I | IPR006424 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G21170.1 | TIM, PDTPI triosephosphate isomerase chr2:9071047-9073106 REVERSE LENGTH=315 | 2.0e-40 | 83% |
RefSeq | Arabidopsis thaliana | NP_001077931.1 | triosephosphate isomerase [Arabidopsis thaliana] | 3.0e-40 | 83% |
RefSeq | Populus trichocarpa | XP_002306169.1 | predicted protein [Populus trichocarpa] | 8.99999e-40 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LM02
Fln msg: Distance to subject end: 42 aas, your sequence is shorter than subject: 79 - 328
Fln protein:
W
Protein Length:
80
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c89097___AGKTFDVCYEQLVAFAVTVPSWDDVVIAYEPVWAIGTGKVASPQQAQEVHVAVREWLSKNVSAKVASQTRIIYGGSVN
B8LM02________________AGKTFDVCYEQLKAFADNVPSWDDVVIAYEPVWAIGTGKVASPQQAQEVHVAVREWLSKNVSAEVASQTRIIYGGSVN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain