UniGene Name: sp_v3.0_unigene133140
Length: 240 nt
UniGene Fasta |
---|
>sp_v3.0_unigene133140
A |
Ace file of the UniGene sp_v3.0_unigene133140 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Tau class glutathione S-transferase n=3 Tax=Pinus RepID=Q4PNY9_PINTB | - | - | 1.0e-15 | 75% |
FL-Next | tr=Tau class glutathione S-transferase; Pinus tabuliformis (Chinese pine) (Pinus leucosperma). | - | - | 0.0 | 75% |
Sma3 | Glutathione S-transferase GSTU6 | - | - | 7.866e-24 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione transferase. | EC:2.5.1.18 | - | 1.968e-36 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione metabolism | 00480 | 1.968e-36 | % | |
Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 1.968e-36 | % | |
Sma3 | Drug metabolism - cytochrome P450 | 00982 | 1.968e-36 | % |
Source | Gene names |
---|---|
Sma3 | 103-1A; At1g59670; At1g59700; At2g29450; At2g29480; B1147A04.23; ERD9; F16P2.17; F23H11.1; GST; GST20; GST30; GST30b; GSTU3; GSTU5; GSVIVT00000141001; GSVIVT00013910001; GSVIVT00013920001; GSVIVT00021415001; GSVIVT00021417001; GSVIVT00021418001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | glutathione transferase activity | GO:0004364 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | glutathione binding | GO:0043295 | Molecular Function | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | toxin catabolic process | GO:0009407 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione S-transferase, N-terminal | IPR004045 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal | IPR004046 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal-like | IPR010987 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Glutathione S-transferase/chloride channel, C-terminal | IPR017933 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G59700.1 | ATGSTU16, GSTU16 glutathione S-transferase TAU 16 chr1:21936459-21937763 FORWARD LENGTH=234 | 7.0e-16 | 63% |
RefSeq | Arabidopsis thaliana | NP_176178.1 | glutathione S-transferase TAU 16 [Arabidopsis thaliana] | 8.0e-16 | 63% |
RefSeq | Populus trichocarpa | XP_002311870.1 | predicted protein [Populus trichocarpa] | 2.0e-11 | 56% |
Full-Lengther Next Prediction |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: Q4PNY9
Fln msg: Distance to subject end: 175 aas, your sequence is shorter than subject: 60 - 237
Fln protein:
M
Protein Length:
61
Fln nts:
A
Fln Alignment:
AllPine_a_c88208___MATEGEKGQVKLLGVTLSPFVVRVCIALALKGIDYE-PEHFMHPKSELLLKSNPVHKKVPV
Q4PNY9________________MAREGEKGQVKLLGATLSPFVVRVRIALALKGIDYEFIQEDLETKSELLLQSNPVYKQIPV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain