UniGene Name: sp_v3.0_unigene132926
Length: 223 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene132926
T |
Ace file of the UniGene sp_v3.0_unigene132926
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | OSJNBa0035M09.2 protein n=2 Tax=Oryza sativa RepID=Q7X8B5_ORYSJ | - | - | 2.0e-09 | 88% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | Autoinhibited calcium ATPase | - | - | 1.31e-33 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Calcium-transporting ATPase. | EC:3.6.3.8 | - | 4.995e-36 | - |
| Source | Gene names |
|---|---|
| Sma3 | ACA10; ACA12; ACA13; ACA8; ACA9; AT5G57110; At3g21180; At3g22910; At3g63380; At3g63380/MAA21_10; At4g29900; At5g57110; B1150F11.11; CA8; CA9; F27B13.140; F5N5.8; GSVIVT00020071001; GSVIVT00020073001; GSVIVT00020075001; GSVIVT00020078001; GSVIVT00020080001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | calcium-transporting ATPase activity | GO:0005388 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | protein self-association | GO:0043621 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
| Sma3 | calcium ion transport | GO:0006816 | Biological Process | 0.0 | - |
| Sma3 | single fertilization | GO:0007338 | Biological Process | 0.0 | - |
| Sma3 | pollen development | GO:0009555 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | inflorescence morphogenesis | GO:0048281 | Biological Process | 0.0 | - |
| Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation-transporter, N-terminal | IPR004014 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation-transporter, C-terminal | IPR006068 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation exchange, alpha subunit | IPR006069 | - | 0.0 | - |
| Sma3 | ATPase, P-type, calcium-transporting, PMCA-type | IPR006408 | - | 0.0 | - |
| Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G57110.1 | ACA8, AT-ACA8 autoinhibited Ca2+ -ATPase, isoform 8 chr5:23109729-23116857 REVERSE LENGTH=1074 | 1.0e-12 | 85% |
| RefSeq | Arabidopsis thaliana | NP_851200.1 | calcium-transporting ATPase 8 [Arabidopsis thaliana] | 2.0e-12 | 85% |
| RefSeq | Populus trichocarpa | XP_002309001.1 | autoinhibited calcium ATPase [Populus trichocarpa] | 3.0e-13 | 88% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5A955
Fln msg: Separated hits, possible frame ERROR between 153 and 159, Distance to subject end: 141 aas, your sequence is shorter than subject: 55 - 197
Fln protein:
M
Protein Length:
56
Fln nts:
T
Fln Alignment:
AllPine_a_rep_c87761___MDTLGALALATESPTDRLMRQPPVGRREPLITxxLWRNVIAQALFQVTVLLIFTF
D5A955________________MDTLGALALATGPPTDQLMRKHPVGRREPLITxxMWRNVIAQALFQVIVLLTLTF

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta