|
||||||
|
UniGene Name: sp_v3.0_unigene132889
Length: 228 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene132889
C |
|
Ace file of the UniGene sp_v3.0_unigene132889
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin [Medicago truncatula] | - | - | 9.0e-20 | 85% |
| FL-Next | tr=Putative polyubiquitin; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 51% |
| Source | Gene names |
|---|---|
| Sma3 | AT5G03240; At2g36170; At4g02890; At4g05050; At4g05320; At5g03240; At5g20620; CHLREDRAFT_140045; EgUbi; FUBI1; GSVIVT00006610001; GSVIVT00027151001; GSVIVT00028185001; GSVIVT00037199001; GUbB1; H0303G06.8; LOC_Os03g13170; LgUBQ; LpUBQ; MICPUCDRAFT_17541; M |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic large ribosomal subunit | GO:0022625 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic small ribosomal subunit | GO:0022627 | Cellular Component | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
| Sma3 | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | - |
| Sma3 | protein neddylation | GO:0045116 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin | IPR000626 | - | 0.0 | - |
| Sma3 | Ribosomal protein L40e | IPR001975 | - | 0.0 | - |
| Sma3 | Ribosomal protein S27a | IPR002906 | - | 0.0 | - |
| Sma3 | Isocitrate lyase/phosphorylmutase, conserved site | IPR018523 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G05320.2 | UBQ10 polyubiquitin 10 chr4:2718559-2719932 FORWARD LENGTH=457 | 6.0e-22 | 85% |
| RefSeq | Arabidopsis thaliana | NP_849301.4 | polyubiquitin 10 [Arabidopsis thaliana] | 7.0e-22 | 85% |
| RefSeq | Populus trichocarpa | XP_002299930.1 | predicted protein [Populus trichocarpa] | 3.0e-22 | 87% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: Q7FPA4
Fln msg: warning!, putative chimeric sequence! or repetitive structureDistance to subject end: 39 aas, atg_distance in limit (1-15): atg_distance = 13, W2: There is no M at the beginning, your sequence is shorter than subject: 76 - 229
Fln protein:
L
Protein Length:
77
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c87680___LTLEVESSDTIDNVKVKIQDREAIPPISNV*SLLGSSSRMVEPLPTTTSRRNPPCISSCILRAGMQIFVKTLTGKT
Q7FPA4________________ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
