UniGene Name: sp_v3.0_unigene131801
Length: 143 nt
UniGene Fasta |
---|
>sp_v3.0_unigene131801
C |
Ace file of the UniGene sp_v3.0_unigene131801 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | wall-associated kinase 4-like [Oryza sativa Japonica Group] dbj|BAG94677.1| unnamed protein product [Oryza sativa Japonica Group] | - | - | 1.0e-11 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Sma3 | Serine/threonine-protein kinase receptor | - | - | 4.769e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT1G79620; AT5G49760; At1g18390; At1g49270; At1g79620; At1g79620/F20B17_5; At5g49760; At5g49760/K2I5_13; At5g49780; B1148D12.10; B1469H02.26; F13F21.28; F15H18.11; F15H18.25; GSVIVT00000553001; GSVIVT00007369001; GSVIVT00018412001; GSVIVT00023226001; GSVI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G18810.1 | Protein kinase superfamily protein chr3:6480701-6483593 REVERSE LENGTH=700 | 1.0e-14 | 66% |
RefSeq | Arabidopsis thaliana | NP_188511.1 | protein kinase family protein [Arabidopsis thaliana] | 2.0e-14 | 66% |
RefSeq | Populus trichocarpa | XP_002327462.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-14 | 62% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWR4
Fln msg: Distance to subject end: 192 aas, your sequence is shorter than subject: 47 - 402
Fln protein:
L
Protein Length:
48
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c85455___LAFLHS-LHPPILHRDVKSSNILLDEDFNVKVADFGLCRLVPDNATHV
A9NWR4________________LSYLHEELVPHIVHRDIKASNVLLDRDLNPKIADFGLAKLFPDNVTHI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain