UniGene Name: sp_v3.0_unigene131645
Length: 221 nt
![]() |
---|
>sp_v3.0_unigene131645
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | Streptomyces cyclase/dehydrase family protein | - | - | 8.439e-09 | - |
Source | Gene names |
---|---|
Sma3 | 23.t00047; 40.t00062; AT4g01020; AT4g17870; ATF3; At1g01360; At1g73000; At2g38310; At2g40330; At4g01020; At4g17870; At5g05440; At5g45860; At5g46790; B1088C09.11; CAPIP1; F3N23.20; F6F3.16; GSVIVT00006507001; GSVIVT00015766001; GSVIVT00029365001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Bet v I domain | IPR000916 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site | IPR002464 | - | 0.0 | - |
Sma3 | Zinc finger, C6HC-type | IPR002867 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | Streptomyces cyclase/dehydrase | IPR005031 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | Helicase-associated domain | IPR007502 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1605 | IPR011709 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G38310.1 | PYL4, RCAR10 PYR1-like 4 chr2:16050251-16050874 FORWARD LENGTH=207 | 1.0e-23 | 68% |
RefSeq | Arabidopsis thaliana | NP_565887.1 | abscisic acid receptor PYL4 [Arabidopsis thaliana] | 2.0e-23 | 68% |
RefSeq | Populus trichocarpa | XP_002312183.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-25 | 77% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQM9
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 54 aas, your sequence is shorter than subject: 73 - 213
Fln protein:
S
Protein Length:
74
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c85167___VKVGCLREVEVVSGLPAVTSIERLDILDEEQHILSFSIVGGEHRLNNYRSITTLHERLI
A9NQM9________________LKVGCLREVRVVSGLPAATSTERLDILDEERHILSFSIVGGDHRLNNYRSITTLHETLI
![]() |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
31 | 66 | 33 | 0.997467 | ||
127 | 25 | 25 | 0.995533 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain