UniGene Name: sp_v3.0_unigene131357
Length: 237 nt
UniGene Fasta |
---|
>sp_v3.0_unigene131357
A |
Ace file of the UniGene sp_v3.0_unigene131357 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | PREDICTED: similar to Tetratricopeptide-like helical n=1 Tax=Vitis vinifera RepID=UPI0001984A05 | - | - | 9.0e-29 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | Tetratricopeptide-like helical | - | - | 2.973e-09 | - |
Source | Gene names |
---|---|
Sma3 | At1g04840; At1g09410; At1g20230; At1g47580; At1g56690; At2g22070; At2g27610; At3g12770; At3g23330; At3g24000; At3g26782; At3g46790; At3g49170; At3g57430; At3g62890; At4g02750; At4g14050; At4g14850; At4g16835; At4g30700; At4g33170; At4g33990; At5g46460; At |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | acireductone synthase activity | GO:0043874 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | L-methionine salvage from methylthioadenosine | GO:0019509 | Biological Process | 0.0 | - |
Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G47580.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:17485668-17486387 FORWARD LENGTH=239 | 9.0e-36 | 68% |
RefSeq | Arabidopsis thaliana | NP_175189.2 | putative lipoyltransferase [Arabidopsis thaliana] | 1.0e-35 | 68% |
RefSeq | Populus trichocarpa | XP_002335047.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-36 | 67% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: your sequence is shorter than subject: 78 - 246
Fln protein:
C
Protein Length:
79
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c84636___KEKYLSYHSEKLAVAFGIINISPGTPIRIVKNLRVCGDCHTAIKFISNTAEREIILRDSNRFHHFKDGVCSCGDYW
D5AAE0________________KEHSLYHHSEKLAIAFGLISTLPGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW
SNPs (tot: 3) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
44 | 33 | 66 | 0.997464 | ||
45 | 33 | 66 | 0.997464 | ||
48 | 66 | 33 | 0.997464 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain