UniGene Name: sp_v3.0_unigene131076
Length: 202 nt
UniGene Fasta |
---|
>sp_v3.0_unigene131076
A |
Ace file of the UniGene sp_v3.0_unigene131076 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative pattern formation protein EMB30 [Arabidopsis thaliana] | - | - | 1.0e-16 | 61% |
FL-Next | sp=Pattern formation protein EMB30; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 61% |
Source | Gene names |
---|---|
Sma3 | At1g13980; At5g39500; EMB30; F16A14.20; F7A19.7; GEP1; GNOM; GSVIVT00015712001; LOC_Os03g46330; OSJNBa0056E06.17; Os03g0666100; OsI_12908; OsJ_12011; PHYPADRAFT_175438; RCOM_0837820; VITISV_034390; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | ARF guanyl-nucleotide exchange factor activity | GO:0005086 | Molecular Function | 0.0 | - |
Sma3 | GTP:GDP antiporter activity | GO:0010292 | Molecular Function | 0.0 | - |
Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
Sma3 | cytokinesis by cell plate formation | GO:0000911 | Biological Process | 0.0 | - |
Sma3 | establishment of planar polarity | GO:0001736 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | cell adhesion | GO:0007155 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Sma3 | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | - |
Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
Sma3 | lateral root primordium development | GO:0010386 | Biological Process | 0.0 | - |
Sma3 | basipetal auxin transport | GO:0010540 | Biological Process | 0.0 | - |
Sma3 | regulation of ARF protein signal transduction | GO:0032012 | Biological Process | 0.0 | - |
Sma3 | regulation of vesicle targeting, to, from or within Golgi | GO:0048209 | Biological Process | 0.0 | - |
Sma3 | root hair cell differentiation | GO:0048765 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SEC7-like | IPR000904 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G13980.1 | GN, VAN7, EMB30 sec7 domain-containing protein chr1:4789587-4794397 FORWARD LENGTH=1451 | 2.0e-21 | 61% |
RefSeq | Arabidopsis thaliana | NP_001184991.1 | Pattern formation protein EMB30 [Arabidopsis thaliana] | 2.0e-21 | 61% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q42510
Fln msg: Distance to subject end: 894 aas, your sequence is shorter than subject: 67 - 1451
Fln protein:
N
Protein Length:
68
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c84059___NCPLSAMHILALDGLIAVIHSMADRVTAASPLPEPVPVKEIEEYAPFWTIKCESYEDANHWVEFVRR
Q42510________________NCPLSAMHILALDGLIAVIQGMAERISNGLTGLDLGPV-HLDEYTPFWMVKCDNYSDPNHWVSFVRR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain