|
||||||
|
UniGene Name: sp_v3.0_unigene130999
Length: 246 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene130999
A |
|
Ace file of the UniGene sp_v3.0_unigene130999
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative casein kinase II beta subunit [Oryza sativa Japonica Group] gb|ABB47995.2| Casein kinase II beta-4 subunit, putative, expressed [Oryza sativa Japonica Group] gb|EEC67455.1| hypothetical protein OsI_34680 [Oryza sativa Indica Group] | - | - | 1.0e-17 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Casein kinase II subunit beta-4 | - | - | 1.681e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | 26.t00110; 40.t00069; At2g44680; At3g60250; At4g17640; At4g17640/dl4855w; At5g47080; CK2B; CKB1; CKB2; CKB3; F16B22.17; F27H5_40; GSVIVT00015872001; GSVIVT00019032001; Hvck2b; K14A3.3; LOC_Os10g41520; MICPUN_107344; OJ1058_B11.121; OSJNBa0027P10.8; Os07g0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase CK2 complex | GO:0005956 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | transcription factor binding | GO:0008134 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase CK2 regulator activity | GO:0008605 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of circadian rhythm | GO:0042753 | Biological Process | 0.0 | - |
| Sma3 | photoperiodism, flowering | GO:0048573 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Casein kinase II, regulatory subunit | IPR000704 | - | 0.0 | - |
| Sma3 | Casein kinase II, regulatory subunit, alpha-helical | IPR016149 | - | 0.0 | - |
| Sma3 | Casein kinase II, regulatory subunit, beta-sheet | IPR016150 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G60250.1 | CKB3 casein kinase II beta chain 3 chr3:22270714-22271962 REVERSE LENGTH=276 | 2.0e-19 | 80% |
| RefSeq | Arabidopsis thaliana | NP_191584.1 | casein kinase 2 subunit beta-3 [Arabidopsis thaliana] | 3.0e-19 | 80% |
| RefSeq | Populus trichocarpa | XP_002327022.1 | predicted protein [Populus trichocarpa] | 3.0e-19 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P2P6
Fln msg: Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 75 - 284
Fln protein:
N
Protein Length:
76
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c83898___NIDGAFFGTTFPHLFLMTYPYIKPAKPIQSYVPKIYGFKIHKSAR
A9P2P6________________NIDGAYFGTTFPHLFLMTYPTVKPPKPVQTYVPRVYGFKLHQSAR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
