SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene130907

Length: 372 nt

UniGene Fasta

>sp_v3.0_unigene130907
ATGGGGTGATACGCCAGATTTGAAGAGATTTGCCATTCGAATCTTAAACCAAGCATGCAGTGCTTCAGGTTGTGAACGCAATTGGAGCATGTTTGAGAAAATACATTCTAAGAAGCGCAACCGATTGACACAAAAACGCTTGAATGACCTTGTATTTGTCCATTACAATCTACGACTTCGCAACAAACAAATACAAGGTATGGATCATTCACCAATCGACCTTGAAGAGATAGATTTGCAAGCTACAAATGCGGCAGAATGGGTTCAATTAGATGAGCCTCCTCTTTTCAGCCTTCATGACTTGGAGAACTTTGCGAGTCAAGCAAGCGAAGGAGTGGAAGGAATCGCTTCTAGTTCTCACTCTTAAGAGTC

Ace file of the UniGene sp_v3.0_unigene130907

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Putative transposase n=1 Tax=Arabidopsis thaliana RepID=O81190_ARATH	-	-	3.0e-21	60%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	60%

Source	Gene names
Sma3	B1007D10.5; GSVIVT00000858001; GSVIVT00001200001; GSVIVT00002236001; GSVIVT00002367001; GSVIVT00006112001; GSVIVT00012114001; GSVIVT00012956001; GSVIVT00017198001; GSVIVT00018900001; GSVIVT00022282001; GSVIVT00034220001; GSVIVT00038590001; LOC_Os12g23430;

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	hydrolase activity, hydrolyzing O-glycosyl compounds	GO:0004553	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	drug transmembrane transporter activity	GO:0015238	Molecular Function	-
Sma3	antiporter activity	GO:0015297	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	protein dimerization activity	GO:0046983	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	drug transmembrane transport	GO:0006855	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Glycoside hydrolase, family 1	IPR001360	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Multi antimicrobial extrusion protein	IPR002528	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Zinc finger, BED-type predicted	IPR003656	-	-
Sma3	Ubiquitin interacting motif	IPR003903	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Domain of unknown function DUF659	IPR007021	-	-
Sma3	Zinc finger, C2H2	IPR007087	-	-
Sma3	HAT dimerisation	IPR008906	-	-
Sma3		IPR011523	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Glycoside hydrolase, subgroup, catalytic domain	IPR013781	-	-
Sma3	Zinc finger, C2H2-like	IPR015880	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G33406.1	hAT dimerisation domain-containing protein / transposase-related chr5:12676126-12678403 REVERSE LENGTH=509	1.0e-21	53%
RefSeq	Arabidopsis thaliana	NP_680299.4	hAT family dimerization domain-containing protein [Arabidopsis thaliana]	1.0e-21	53%
RefSeq	Populus trichocarpa	XP_002311919.1	predicted protein [Populus trichocarpa]	4.0e-19	46%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5A8W4

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 91 aas, your sequence is shorter than subject: 122 - 478

Fln protein: WGDTPDLKRFAIRILNQACSASGCERNWSMFEKIHSKKRNRLTQKRLNDLVFVHYNLRLRNKQIQGMDHSPIDLEEIDLQATNAAEWVQLDEPPLFSLHDLENFASQASEGVEGIASSSHS*

Protein Length: 123

Fln nts: ATGGGGTGATACGCCAGATTTGAAGAGATTTGCCATTCGAATCTTAAACCAAGCATGCAGTGCTTCAGGTTGTGAACGCAATTGGAGCATGTTTGAGAAAATACATTCTAAGAAGCGCAACCGATTGACACAAAAACGCTTGAATGACCTTGTATTTGTCCATTACAATCTACGACTTCGCAACAAACAAATACAAGGTATGGATCATTCACCAATCGACCTTGAAGAGATAGATTTGCAAGCTACAAATGCGGCAGAATGGGTTCAATTAGATGAGCCTCCTCTTTTCAGCCTTCATGACTTGGAGAACTTTGCGAGTCAAGCAAGCGAAGGAGTGGAAGGAATCGCTTCTAGTTCTCACTCTTAAGAGTC

Fln Alignment:

AllPine_a_rep_c83719___TPDLKRFAIRILNQACSASGCERNWSMFEKIHSKKRNRLTQKRLNDLVFVHYNLRLRNKQIQ-GMDHSPIDLEEIDLQATNAAEWVQLDEP
D5A8W4________________TPILQKMAIRVLSQTCSSSGCERNWSVFEKIHTKKRNRLDTSCLNDLVYVHYNLRLWVKQLEIKIDARAISLDEID---TTAAWRVEVEEP

SNPs (tot: 2)

Position	A %	C %	G %	T %	Probability
175		66		33	0.997455
232	66			33	0.997458

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain