|
||||||
|
UniGene Name: sp_v3.0_unigene130863
Length: 185 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene130863
G |
|
Ace file of the UniGene sp_v3.0_unigene130863
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ubiquitin-protein ligase 2 [Arabidopsis thaliana] | - | - | 2.0e-23 | 83% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 46% |
| Sma3 | E3 ubiquitin protein ligase upl2, putative | - | - | 8.71e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g55860; At1g70320; CHLREDRAFT_129201; F14J16.14; F14J16.37; F17O7.14; F17O7.15; GSVIVT00015074001; GSVIVT00033390001; LOC_Os12g24080; MICPUCDRAFT_35032; MICPUN_59359; OSTLU_41898; OSTLU_52147; Os09g0252800; Os12g0428600; OsI_30556; OsI_38149; OsJ_28543 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | acid-amino acid ligase activity | GO:0016881 | Molecular Function | 0.0 | - |
| Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin-associated/translation elongation factor EF1B, N-terminal | IPR000449 | - | 0.0 | - |
| Sma3 | HECT | IPR000569 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Ubiquitin interacting motif | IPR003903 | - | 0.0 | - |
| Sma3 | E3 ubiquitin ligase, domain of unknown function DUF908 | IPR010309 | - | 0.0 | - |
| Sma3 | E3 ubiquitin ligase, domain of unknown function DUF913 | IPR010314 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Ubiquitin-associated/translation elongation factor EF1B, N-terminal, eukaryote | IPR015940 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G70320.1 | UPL2 ubiquitin-protein ligase 2 chr1:26488745-26501281 REVERSE LENGTH=3658 | 2.0e-29 | 83% |
| RefSeq | Arabidopsis thaliana | NP_177189.1 | ubiquitin-protein ligase 2 [Arabidopsis thaliana] | 3.0e-29 | 83% |
| RefSeq | Populus trichocarpa | XP_002301117.1 | predicted protein [Populus trichocarpa] | 3.0e-31 | 85% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKQ9
Fln msg: Distance to subject end: 43 aas, your sequence is shorter than subject: 61 - 1032
Fln protein:
Y
Protein Length:
62
Fln nts:
G
Fln Alignment:
AllPine_a_rep_c83631___YTSASPVVQWFWEVVQSFSKEDMARLLQFITGTSKVPLEGFKALQ
B8LKQ9________________YSEDHPVIEMFWEVIKQFSLEQQKKFLKFVTGCSRGPLLGFKYLE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
