|
||||||
|
UniGene Name: sp_v3.0_unigene130571
Length: 236 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene130571
A |
|
Ace file of the UniGene sp_v3.0_unigene130571
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Wax2_C domain containing protein | - | - | 1.0e-18 | 43% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 61% |
| Sma3 | Gl1 protein | - | - | 5.669e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g57800; FLP1; GSVIVT00017093001; GSVIVT00025204001; GSVIVT00025206001; MTI20.3; OJ1299_A11.27; OSJNBa0085J13.13; Os02g0178800; Os06g0653000; Os09g0426800; OsI_06088; OsI_23945; OsI_31436; OsJ_22195; OsJ_29433; P0544B02.10; PHYPADRAFT_108743; PHYPADRAFT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
| Sma3 | cuticle hydrocarbon biosynthetic process | GO:0006723 | Biological Process | 0.0 | - |
| Sma3 | wax biosynthetic process | GO:0010025 | Biological Process | 0.0 | - |
| Sma3 | pollen sperm cell differentiation | GO:0048235 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
| Sma3 | Fatty acid hydroxylase | IPR006694 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G57800.1 | FLP1, YRE, CER3, WAX2 Fatty acid hydroxylase superfamily chr5:23420589-23423832 FORWARD LENGTH=632 | 8.0e-27 | 71% |
| RefSeq | Arabidopsis thaliana | NP_200588.2 | protein WAX2 [Arabidopsis thaliana] | 1.0e-26 | 71% |
| RefSeq | Populus trichocarpa | XP_002325096.1 | predicted protein [Populus trichocarpa] | 1.0e-26 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ACZ9
Fln msg: your sequence is shorter than subject: 67 - 283
Fln protein:
M
Protein Length:
68
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c83020___ELPEDVEGLGSCEFGC-Q*IVHACHAGGVVHSLEGWEHHEVGAIDVDRIDIVWKEAIKHGLKAVQ
D5ACZ9________________QLPDAVEGLSTCEYTMPRRCVHACHAGGILHSLEGWEHHEVGAIDVNKIDMVWEAALNHGFKPMK
| SNPs (tot: 6) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 77 | 33 | 66 | 0.997458 | ||
| 81 | 66 | 33 | 0.997458 | ||
| 84 | 33 | 66 | 0.997458 | ||
| 85 | 33 | 66 | 0.997458 | ||
| 86 | 33 | 66 | 0.997458 | ||
| 87 | 66 | 33 | 0.997458 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
