SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene130012

Length: 349 nt

UniGene Fasta

>sp_v3.0_unigene130012
GTGCCTTGCAATGACGTTATCTAAGCCTTCCTCAACTAATATAAGATCTAGAGCAGCCCGCAGTCCGTATGGATGAATGGGGAGTGGATGTAGCGCTAACAGGTTCTCAAAAGGCTCTGTCCTTGCCAACAGGTCTTGGTATTTTAGTTTGTTTGTTTGTCTAAGCCCAAAGGCTTTAGAAGCAGCAAAGACTGCAAAGTCGCTAAGGGTATTCTTTGACTGGAACGACTATTTGAAGTTCTATAAGTTGGGGACGTATTGGCCCTACACACCATCAATTCAACTCCTATATGGACTGCAGGCTGCTCTACATCTTATATTAGTTGAGGAAGGCTTAGATAACGTCATT

Ace file of the UniGene sp_v3.0_unigene130012

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Serine-glyoxylate aminotransferase n=2 Tax=Liliopsida RepID=Q3S2I1_SPIPO	-	-	2.0e-35	86%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	96%
Sma3	Alanine:glyoxylate aminotransferase	-	-	1.49939e-43	-

Source	ECs	Term	Type	e value	Identity
Sma3	Alanine--glyoxylate transaminase.	EC:2.6.1.44	-	1.10198e-41	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Alanine, aspartate and glutamate metabolism	00250		1.10198e-41	%
Sma3	Glycine, serine and threonine metabolism	00260		1.10198e-41	%
Sma3	Metabolic pathways	01100		1.10198e-41	%
Sma3	Serine--glyoxylate transaminase.	EC:2.6.1.45	-	5.703e-11	-

Source	KEGGs	Term	e value	Identity
Sma3	Glycine, serine and threonine metabolism	00260	5.703e-11	%
Sma3	Methane metabolism	00680	5.703e-11	%
Sma3	Metabolic pathways	01100	5.703e-11	%
Sma3	Biosynthesis of secondary metabolites	01110	5.703e-11	%

Source	Gene names
Sma3	AGT1; At2g13360; CAT1; F14O4.7; GSVIVT00022240001; OJ1345_D02.38; OJ1506_F01.10; Os08g0502700; OsI_29783; OsJ_27850; PHYPADRAFT_176699; PHYPADRAFT_199392; PHYPADRAFT_210069; POPTRDRAFT_723016; POPTRDRAFT_815301; RCOM_0063050; SGA; SGT2; SGT3; VITISV_00768

Source	GOs	Term	Type	Identity
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	serine-pyruvate transaminase activity	GO:0004760	Molecular Function	-
Sma3	alanine-glyoxylate transaminase activity	GO:0008453	Molecular Function	-
Sma3	transaminase activity	GO:0008483	Molecular Function	-
Sma3	pyridoxal phosphate binding	GO:0030170	Molecular Function	-
Sma3	serine-glyoxylate transaminase activity	GO:0050281	Molecular Function	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	photorespiration	GO:0009853	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Aminotransferase, class V/Cysteine desulfurase	IPR000192	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 1	IPR015421	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 2	IPR015422	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G13360.1	AGT, AGT1, SGAT alanine:glyoxylate aminotransferase chr2:5539417-5540902 REVERSE LENGTH=401	9.0e-38	84%
RefSeq	Arabidopsis thaliana	NP_849951.1	serine--glyoxylate aminotransferase [Arabidopsis thaliana]	1.0e-37	84%
RefSeq	Populus trichocarpa	XP_002298306.1	predicted protein [Populus trichocarpa]	8.0e-36	83%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PPQ8

Fln msg: Separated hits, possible frame ERROR between 146 and 155, Unexpected stop codon in the beginning of your sequence, Distance to subject end: 126 aas, your sequence is shorter than subject: 116 - 401

Fln protein: ALQ*RYLSLPQLI*DLEQPAVRMDEWGVDVALTGSQKALSLPTGLGIxxxxVCLSPKALEAAKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLQAALHLILVEEGLDNVI

Protein Length: 117

Fln nts: GTGCCTTGCAATGACGTTATCTAAGCCTTCCTCAACTAATATAAGATCTAGAGCAGCCCGCAGTCCGTATGGATGAATGGGGAGTGGATGTAGCGCTAACAGGTTCTCAAAAGGCTCTGTCCTTGCCAACAGGTCTTGGTATTTTxxxxxxxxxTGTTTGTCTAAGCCCAAAGGCTTTAGAAGCAGCAAAGACTGCAAAGTCGCTAAGGGTATTCTTTGACTGGAACGACTATTTGAAGTTCTATAAGTTGGGGACGTATTGGCCCTACACACCATCAATTCAACTCCTATATGGACTGCAGGCTGCTCTACATCTTATATTAGTTGAGGAAGGCTTAGATAACGTCATT

Fln Alignment:

AllPine_a_rep_c81694___RMDEWGVDVALTGSQKALSLPTGLGILxxxVCLSPKALEAAKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLQAALHLILVEEGLDNVI
C0PPQ8________________RMDEWGVDVALTGSQKALSLPTGLGIVxxxVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFL-EGLDNVI

SSRs (tot: 1)

Start position	End position	Sequence	Length
147	160	GTTT GTTT GTTT GT	14

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain