SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene129643

Length: 378 nt

UniGene Fasta

>sp_v3.0_unigene129643
CGTCGTGACCTTGGCTGTCACTCAATTGCTTTTGGGATTATTAATACAAGATCTGGGACATCTATTCGGATCACTAAAAACCTCCGTGTCTGTAACAGCTGCCACAGTGCTGCCAAATTCATTTCCAAGATCGCCCAGCGGGAAATTATTATTAGGGATATAAACCGTTTCCATCATTTCAAAAGTGGATCGTGTTCTTGTGGGGATTACTGGTGATACTAATCATGACAAGCAAATATTAACTTGCATGATAGAAATATAAACGTGCTATTTGCCATATGTTTGCAGACAAGATCTCATTGATAGAGTCAAAGACACTTTGCACATTGGATGATATCTGCATAGCAGTGGCTCCTTAGGATGGCAGTATGTTTACAT

Ace file of the UniGene sp_v3.0_unigene129643

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp\|Q7Y211.2\|PP285_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g57430, chloroplastic; Flags: Precursor gb\|AEE79654.1\| pentatricopeptide repeat-containing protein [Ara	-	-	2.0e-22	71%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	81%
Sma3	Pentatricopeptide (PPR) repeat-containing protein-like	-	-	6.154e-10	-

Source	Gene names
Sma3	At1g04840; At1g08070; At1g11290; At1g18485; At1g20230; At1g47580; At1g56690; At2g02980; At2g22070; At3g12770; At3g22690; At3g23330; At3g24000; At3g26782; At3g46790; At3g49170; At3g56550; At3g57430; At4g02750; At4g16835; At4g30700; At4g33170; At4g33990; At

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	nuclease activity	GO:0004518	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	acireductone synthase activity	GO:0043874	Molecular Function	-
Sma3	metal ion binding	GO:0046872	Molecular Function	-
Sma3	nucleotide-excision repair	GO:0006289	Biological Process	-
Sma3	translation	GO:0006412	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	RNA modification	GO:0009451	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	thylakoid membrane organization	GO:0010027	Biological Process	-
Sma3	photosystem II assembly	GO:0010207	Biological Process	-
Sma3	regulation of chlorophyll biosynthetic process	GO:0010380	Biological Process	-
Sma3	mRNA modification	GO:0016556	Biological Process	-
Sma3	L-methionine salvage from methylthioadenosine	GO:0019509	Biological Process	-
Sma3	chloroplast RNA processing	GO:0031425	Biological Process	-
Sma3	polycistronic mRNA processing	GO:0031426	Biological Process	-
Sma3	photosystem I assembly	GO:0048564	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Ribosomal protein S3, C-terminal	IPR001351	-	-
Sma3	UVR domain	IPR001943	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	K Homology domain, type 2	IPR004044	-	-
Sma3	K Homology domain	IPR004087	-	-
Sma3	Haloacid dehalogenase-like hydrolase	IPR005834	-	-
Sma3	2,3-diketo-5-methylthio-1-phosphopentane phosphatase	IPR010041	-	-
Sma3	Hemimethylated DNA-binding domain	IPR011722	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Methyltransferase type 11	IPR013216	-	-
Sma3		IPR018115	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G23330.1	Tetratricopeptide repeat (TPR)-like superfamily protein chr3:8347200-8349347 FORWARD LENGTH=715	3.0e-27	68%
RefSeq	Arabidopsis thaliana	NP_188975.3	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	3.0e-27	68%
RefSeq	Populus trichocarpa	XP_002299387.1	predicted protein [Populus trichocarpa]	2.0e-28	73%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: D5ADG9

Fln msg: your sequence is shorter than subject: 72 - 312

Fln protein: RRDLGCHSIAFGIINTRSGTSIRITKNLRVCNSCHSAAKFISKIAQREIIIRDINRFHHFKSGSCSCGDYW*

Protein Length: 73

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATTGCTTTTGGGATTATTAATACAAGATCTGGGACATCTATTCGGATCACTAAAAACCTCCGTGTCTGTAACAGCTGCCACAGTGCTGCCAAATTCATTTCCAAGATCGCCCAGCGGGAAATTATTATTAGGGATATAAACCGTTTCCATCATTTCAAAAGTGGATCGTGTTCTTGTGGGGATTACTGGTGA___TACTAATCATGACAAGCAAATATTAACTTGCATGATAGAAATATAAACGTGCTATTTGCCATATGTTTGCAGACAAGATCTCATTGATAGAGTCAAAGACACTTTGCACATTGGATGATATCTGCATAGCAGTGGCTCCTTAGGATGGCAGTATGTTTACAT

Fln Alignment:

AllPine_a_rep_c80903___SIAFGIINTRSGTSIRITKNLRVCNSCHSAAKFISKIAQREIIIRDINRFHHFKSGSCSCGDYW
D5ADG9________________AIAFGLISTRSGTSIRITKNLRVCGDCHSATKFISKIVKREIIMRDLNRFHHFKDGLCSCGDYW

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain