SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene129227

Length: 520 nt

UniGene Fasta

>sp_v3.0_unigene129227
CGTCGTGACCTTGGCTGTCACTCATATATGATCTTTTTATTGTTGGAGGGGCCTTCTATGGAGCGGTTACATTCTTAGGGCTTAGCAACTGTTCAACTGTACAGCCTGTGGTTGCAGTAGAGAGAACTGTGTTCTACAGAGAAAGGGCTGCAGGACTATACTCTGCTTTGCCATATGCTCTGGCTCAGGTAGTGATTGAGCTTCCGTACATATTCGTCCAGACAGTTATGTACACTCTTATCGTTTACAGTATGATCCATTTTGAGTGGACAACTACTAAGTTTGGCTGGTTCTTCTTGCTGAACTACTTCACATTTCTGTACTTCACCTATTATGGGATGATGACGGTCTCCATTACTTGGCCCCAACAAGTTGCCTCAATAGTAGCTTCAGCTTTCTACTGCCTTTTCAATCTGTTTTCAGGGTTCTTCATTCCTAAACCGGTATGTAACCTACTTTGTCCTGTTTCTTTATACTAAACTTTATGGACCCATATAAGTAGGCCAGAATAGAATGTAAG

Ace file of the UniGene sp_v3.0_unigene129227

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	ATP-binding cassette transporter n=1 Tax=Selaginella moellendorffii RepID=D8T797_SELML	-	-	5.60519e-45	65%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	61%
Sma3	ATP-binding cassette transporter, putative	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Phosphonate-transporting ATPase.	EC:3.6.3.28	-	0.0	-
Sma3	Heme-transporting ATPase.	EC:3.6.3.41	-	7.166e-11	-

Source	Gene names
Sma3	ABC1; At1g15210; At1g15520; At1g59870; At1g66950; At2g26910; At2g29940; At2g36380; At2g37280; At3g16340; At3g30842; At3g53480; B1045F02.15; B1090H08.39; F12C20.5; F1O11.1; F1O19.3; F23F1.14; F23H11.19; F3G5.7; F4P12.180; F9L1.15; GSVIVT00000322001; GSVIVT

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	cadmium ion transmembrane transporter activity	GO:0015086	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to biotic stimulus	GO:0009607	Biological Process	-
Sma3	systemic acquired resistance	GO:0009627	Biological Process	-
Sma3	response to ethylene stimulus	GO:0009723	Biological Process	-
Sma3	response to salicylic acid stimulus	GO:0009751	Biological Process	-
Sma3	response to jasmonic acid stimulus	GO:0009753	Biological Process	-
Sma3	defense response to fungus, incompatible interaction	GO:0009817	Biological Process	-
Sma3	response to ozone	GO:0010193	Biological Process	-
Sma3	cadmium ion transport	GO:0015691	Biological Process	-
Sma3	lead ion transport	GO:0015692	Biological Process	-
Sma3	negative regulation of defense response	GO:0031348	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ribosomal protein L11	IPR000911	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Proteinase inhibitor I2, Kunitz metazoa	IPR002223	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	ATPase, AAA-type, core	IPR003959	-	-
Sma3	Pleiotropic drug resistance protein PDR	IPR005285	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	ABC-2 type transporter	IPR013525	-	-
Sma3	Plant PDR ABC transporter associated	IPR013581	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT1G15210.1	PDR7, ATPDR7 pleiotropic drug resistance 7 chr1:5231552-5236573 REVERSE LENGTH=1442	68%
RefSeq	Arabidopsis thaliana	NP_172973.1	ABC transporter G family member 35 [Arabidopsis thaliana]	68%
RefSeq	Populus trichocarpa	XP_002298240.1	ABC transporter family, pleiotropic drug resistance protein [Populus trichocarpa]	71%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5ACV1

Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 64 aas, your sequence is shorter than subject: 159 - 412

Fln protein: S*PWLSLIYDLFIVGGAFYGAVTFLGLSNCSTVQPVVAVERTVFYRERAAGLYSALPYALAQVVIELPYIFVQTVMYTLIVYSMIHFEWTTTKFGWFFLLNYFTFLYFTYYGMMTVSITWPQQVASIVASAFYCLFNLFSGFFIPKPVCNLLCPVSLY*

Protein Length: 160

Fln nts: CGTCGTGACCTTGGCTGTCACTCATATATGATCTTTTTATTGTTGGAGGGGCCTTCTATGGAGCGGTTACATTCTTAGGGCTTAGCAACTGTTCAACTGTACAGCCTGTGGTTGCAGTAGAGAGAACTGTGTTCTACAGAGAAAGGGCTGCAGGACTATACTCTGCTTTGCCATATGCTCTGGCTCAGGTAGTGATTGAGCTTCCGTACATATTCGTCCAGACAGTTATGTACACTCTTATCGTTTACAGTATGATCCATTTTGAGTGGACAACTACTAAGTTTGGCTGGTTCTTCTTGCTGAACTACTTCACATTTCTGTACTTCACCTATTATGGGATGATGACGGTCTCCATTACTTGGCCCCAACAAGTTGCCTCAATAGTAGCTTCAGCTTTCTACTGCCTTTTCAATCTGTTTTCAGGGTTCTTCATTCCTAAACCGGTATGTAACCTACTTTGTCCTGTTTCTTTATACTAAACTTTATGGACCCATATAAGTAGGCCAGAATAGAATGTAAG

Fln Alignment:

AllPine_a_rep_c79868___DLFIVGGAFYGAVTFLGLSNCSTVQPVVAVERTVFYRERAAGLYSALPYALAQVVIELPYIFVQTVMYTLIVYSMIHFEWTTTKFGWXXXXXXXXXXXXXXXGMMTVSITWPQQVASIVASAFYCLFNLFSGFFIPKP
D5ACV1________________DLFNVLGAMYASTIFLGVSNSSTVQPVVGVQRTVFYREKAAGMYSAIPYAVAQTAIEIPYILIQTTIYSLIVYSMIDFQWTTVKFFWFLFYMFMCFVYFTLYGMMAVALTPGHQIAAIVSSFFYGFWNIFSGFLITRP

SNPs (tot: 15)

Position	A %	C %	G %	T %	Probability
108		40		60	1.0
111		33	66		1.0
114			33	66	1.0
115	33		66		1.0
117	66	33			1.0
118			66	33	1.0
120	66		33		1.0
122	66	33			1.0
123			66	33	1.0
124	66		33		1.0
125			66	33	1.0
126	66	33			1.0
131	33		66		1.0
361		66	33		0.997471
362	33			66	0.997471

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain