SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene128902

Length: 368 nt

UniGene Fasta

>sp_v3.0_unigene128902
GCTTCATGATGTGCAGGAGGAACAGAAGGGAGCACTTCTTTCCTTTCATAGTGAGAAGCTGGCAGTTGCCTTTGGGCTTATCAGTACACCAATGGAGACAACTATAAGGATCATGAAGAATCTTCGAATGTGTGGTGATTGCCACAATGCCATCAAATTCATATCCAAGGTTGTTAAGAGAGAAATTGTGTGAGCTCTACAAAAATCGTATTCCATCATTTCAAGGATGGAGTTTGTTCCTGTAGGGATTATTGGTGACAGTATGTTGAATGAGTAGCAAAGTAATCAGTGATATTTTGTGGGCAGGTTGGGTTCACATATGTATCATTCTGCTTCAAGGAATGTTGAGGTGTGATTATGGTAGATAA

Ace file of the UniGene sp_v3.0_unigene128902

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp\|Q9SHZ8.1\|PP168_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g22070 gb\|AAD25817.1\| hypothetical protein [Arabidopsis thaliana] gb\|AEC07259.1\| pentatricopeptide repe	-	-	5.0e-25	71%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	71%
Sma3	Pentatricopeptide repeat protein	-	-	3.097e-16	-

Source	Gene names
Sma3	At1g09410; At1g18485; At1g20230; At1g47580; At1g56690; At2g22070; At3g02010; At3g23330; At3g26782; At3g49170; At3g57430; At4g16835; At4g21065; At4g30700; At4g33170; At5g39680; B21F5.9; DYW10; DYW9; EMB2261; EMB2744; F14J9.7; F15H18.4; F16N3.14; F1C9.21; F

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	acireductone synthase activity	GO:0043874	Molecular Function	-
Sma3	metal ion binding	GO:0046872	Molecular Function	-
Sma3	DNA methylation	GO:0006306	Biological Process	-
Sma3	translation	GO:0006412	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	L-methionine salvage from methylthioadenosine	GO:0019509	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Ribosomal protein S3, C-terminal	IPR001351	-	-
Sma3	C-5 cytosine methyltransferase	IPR001525	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	MAP kinase, conserved site	IPR003527	-	-
Sma3	K Homology domain, type 2	IPR004044	-	-
Sma3	K Homology domain	IPR004087	-	-
Sma3	Haloacid dehalogenase-like hydrolase	IPR005834	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	2,3-diketo-5-methylthio-1-phosphopentane phosphatase	IPR010041	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Thioredoxin, conserved site	IPR017937	-	-
Sma3		IPR018115	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G22070.1	pentatricopeptide (PPR) repeat-containing protein chr2:9383602-9385962 FORWARD LENGTH=786	4.0e-27	71%
RefSeq	Arabidopsis thaliana	NP_179798.1	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	5.0e-27	71%
RefSeq	Populus trichocarpa	XP_002310592.1	predicted protein [Populus trichocarpa]	5.0e-27	69%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: A9P0W0

Fln msg: Separated hits, possible frame ERROR between 190 and 211, your sequence is shorter than subject: 86 - 370

Fln protein: LHDVQEEQKGALLSFHSEKLAVAFGLISTPMETTIRIMKNLRMCGDCHNAIKFISKVVKREIxxxxxxxxFHHFKDGVCSCRDYW*

Protein Length: 87

Fln nts: GCTTCATGATGTGCAGGAGGAACAGAAGGGAGCACTTCTTTCCTTTCATAGTGAGAAGCTGGCAGTTGCCTTTGGGCTTATCAGTACACCAATGGAGACAACTATAAGGATCATGAAGAATCTTCGAATGTGTGGTGATTGCCACAATGCCATCAAATTCATATCCAAGGTTGTTAAGAGAGAAATTGTxxxxxxxxxxxxxxxxxxxxxATTCCATCATTTCAAGGATGGAGTTTGTTCCTGTAGGGATTATTGGTGACAGTATGTTGAATGAGTAGCAAAGTAATCAGTGATATTTTGTGGGCAGGTTGGGTTCACATATGTATCATTCTGCTTCAAGGAATGTTGAGGTGTGATTATGGTAGATAA

Fln Alignment:

AllPine_a_rep_c78848___LHDVQEEQKGALLSFHSEKLAVAFGLISTPMETTIRIMKNLRMCGDCHNAIKFISKVVKREIVxxxxxxxFHHFKDGVCSCRDYW
A9P0W0________________LHDVEEEQKEWILGHHSEKLAIAFGIISTPPGTTIRVVKNLRVCGDCHTATKFISRIVSREIVxxxxxxxFHHFKDGQCSCGDYW

SNPs (tot: 3)

Position	A %	C %	G %	T %	Probability
215	33	66			1.0
217			33	66	1.0
294		25		75	0.996481

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain