SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene127748

Length: 295 nt

UniGene Fasta

>sp_v3.0_unigene127748
AGCAGGAGCTGGAATTGTGGGCATATTAAAGAAATCAGGGAGAGATGTCATTGGAGAGACGTCGTAAACTGAGGACTGTTGTCTCAATTGATGGAGGTCTGTATGAGCACTATCCACTTTTCAGACATAATATGCAGAGTGCTGTTAAAGAATTGCTTGGAAGTGAGGTTTCGGAAACTGTGGTTTTAGAACTTGCAAATGATGGTTCAGGTATTGGGGCTACTCTTCTTGCTGCATCTAACTCAAGGTATTCAAAGAAATCTTGATGCAAAAACTCCAGAACTCAGTCGTCGTT

Ace file of the UniGene sp_v3.0_unigene127748

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Hexokinase n=1 Tax=Citrus sinensis RepID=Q9FVD3_CITSI	-	-	5.0e-18	60%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	90%
Sma3	Hexokinase-2	-	-	7.35e-11	-

Source	ECs	Term	Type	e value	Identity
Sma3	Hexokinase.	EC:2.7.1.1	-	1.36486e-42	-

Source	KEGGs	Term	e value	Identity
Sma3	Glycolysis / Gluconeogenesis	00010	1.36486e-42	%
Sma3	Fructose and mannose metabolism	00051	1.36486e-42	%
Sma3	Galactose metabolism	00052	1.36486e-42	%
Sma3	Starch and sucrose metabolism	00500	1.36486e-42	%
Sma3	Amino sugar and nucleotide sugar metabolism	00520	1.36486e-42	%
Sma3	Biosynthesis of phenylpropanoids	01061	1.36486e-42	%
Sma3	Biosynthesis of terpenoids and steroids	01062	1.36486e-42	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	1.36486e-42	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	1.36486e-42	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	1.36486e-42	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	1.36486e-42	%
Sma3	Biosynthesis of plant hormones	01070	1.36486e-42	%
Sma3	Metabolic pathways	01100	1.36486e-42	%
Sma3	Biosynthesis of secondary metabolites	01110	1.36486e-42	%

Source	Gene names
Sma3	At2g19860; F6F22.11; GSVIVT00014427001; HXK1; HXK2; HXK4; HXK5; HXK6; HXK8; Hxk1a; Hxk2; Hxk3; Hxk6; HxkRP1; LOC_Os01g53930; LOC_Os05g44760; LOC_Os07g09890; LOC_Os07g26540; OJ1087_C03.12; OSJNBa0075A10.5; Os01g0190400; Os01g0742500; Os05g0522500; Os07g019

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	mitochondrial outer membrane	GO:0005741	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	plastid outer membrane	GO:0009527	Cellular Component	-
Sma3	plastid	GO:0009536	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	glucokinase activity	GO:0004340	Molecular Function	-
Sma3	hexokinase activity	GO:0004396	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	fructokinase activity	GO:0008865	Molecular Function	-
Sma3	transcription regulator activity	GO:0030528	Molecular Function	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	hexokinase-dependent signaling	GO:0009747	Biological Process	-
Sma3	sugar mediated signaling pathway	GO:0010182	Biological Process	-
Sma3	programmed cell death	GO:0012501	Biological Process	-
Sma3		GO:0045449	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Transcription factor TFIIB	IPR000812	-	-
Sma3		IPR001092	-	-
Sma3	Hexokinase	IPR001312	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G19860.1	ATHXK2, HXK2 hexokinase 2 chr2:8570818-8573762 FORWARD LENGTH=502	3.0e-18	60%
RefSeq	Arabidopsis thaliana	NP_001077921.1	hexokinase 2 [Arabidopsis thaliana]	2.0e-18	60%
RefSeq	Populus trichocarpa	XP_002306924.1	predicted protein [Populus trichocarpa]	8.0e-21	66%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LRJ7

Fln msg: Separated hits, possible frame ERROR between 61 and 66, your sequence is shorter than subject: 89 - 551

Fln protein: AGAGIVGILKKSGRDVIGExxxKLRTVVSIDGGLYEHYPLFRHNMQSAVKELLGSEVSETVVLELANDGSGIGATLLAASNSRYSKKS*

Protein Length: 90

Fln nts: AGCAGGAGCTGGAATTGTGGGCATATTAAAGAAATCAGGGAGAGATGTCATTGGAGAGACxxxxxxTAAACTGAGGACTGTTGTCTCAATTGATGGAGGTCTGTATGAGCACTATCCACTTTTCAGACATAATATGCAGAGTGCTGTTAAAGAATTGCTTGGAAGTGAGGTTTCGGAAACTGTGGTTTTAGAACTTGCAAATGATGGTTCAGGTATTGGGGCTACTCTTCTTGCTGCATCTAACTCAAGGTATTCAAAGAAATCTTGATGCAAAAACTCCAGAACTCAGTCGTCGTT

Fln Alignment:

AllPine_a_rep_c73293___AGAGIVGILKKSGRDVIGETxxKLRTVVSIDGGLYEHYPLFRHNMQSAVKELLGSEVSETVVLELANDGSGIGATLLAASNSRYSKKS
B8LRJ7________________AGAGIVGILKKLGRDVIGDTxxKMRTVVAIDGGLYEHYSFFRQNMQSAVKELLGSEVSETVVLELSSDGSGIGATLLAASNSRYSKKS

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain