SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene126810

Length: 263 nt

UniGene Fasta

>sp_v3.0_unigene126810
GCATTATAGAGGAGTTAGGAAGAGGCCCTGGGGAAAATACGCGGCGGAGATCCGAGATTCCACGAGGCACGGAGTTCGAGTCTGGTTGGGGACTTTTGAAACGGGGGAGGAGGCGGCCATGGCTTATGATCAGGCTGCCTTCGCCATGAGAGGCTCCAACGCGATTCTCAATTTCCCCCTTGAAGTTGTTTGCGGCTCCTTCAAACGCCGCCAGGTCCTTCCGGCTTCCAGCGCCAAATTCTCCGGCGGTACCTCTGAAATTT

Ace file of the UniGene sp_v3.0_unigene126810

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	ERF transcription factor 4 n=1 Tax=Vitis pseudoreticulata RepID=D3Y3F3_9ROSI	-	-	4.0e-19	65%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	79%
Sma3	AP2/ERF domain-containing transcription factor	-	-	0.0	-

Source	Gene names
Sma3	24.t00032; 24.t00040; 25.t00062; 26.t00057; 27.t00030; 46C02.12; ACRE1; At1g04370; At1g06160; At2g31230; At3g23220; At3g23230; At3g23240; At4g17490; At4g17500; At4g18450; At5g43410; At5g47220; At5g47230; At5g51190; At5g61600; B1234D02.6; B1331F11.13; B133

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	monooxygenase activity	GO:0004497	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	transcription activator activity	GO:0016563	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	response to jasmonic acid stimulus	GO:0009753	Biological Process	-
Sma3	fruit ripening	GO:0009835	Biological Process	-
Sma3	jasmonic acid and ethylene-dependent systemic resistance	GO:0009861	Biological Process	-
Sma3	induced systemic resistance, jasmonic acid mediated signaling pathway	GO:0009864	Biological Process	-
Sma3	jasmonic acid mediated signaling pathway	GO:0009867	Biological Process	-
Sma3	ethylene mediated signaling pathway	GO:0009873	Biological Process	-
Sma3	response to chitin	GO:0010200	Biological Process	-
Sma3		GO:0045941	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Signal recognition particle, SRP54 subunit, GTPase	IPR000897	-	-
Sma3	Cytochrome P450	IPR001128	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	AP2/ERF domain	IPR001471	-	-
Sma3	Major facilitator superfamily	IPR011701	-	-
Sma3	DNA ligase, ATP-dependent, conserved site	IPR016059	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G43410.1	Integrase-type DNA-binding superfamily protein chr5:17435010-17435405 REVERSE LENGTH=131	2.0e-23	64%
RefSeq	Arabidopsis thaliana	NP_199154.1	ethylene-responsive transcription factor ERF096 [Arabidopsis thaliana]	2.0e-23	64%
RefSeq	Populus trichocarpa	XP_002305766.1	AP2/ERF domain-containing transcription factor [Populus trichocarpa]	3.0e-25	67%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NRQ5

Fln msg: Distance to subject end: 63 aas, your sequence is shorter than subject: 87 - 350

Fln protein: HYRGVRKRPWGKYAAEIRDSTRHGVRVWLGTFETGEEAAMAYDQAAFAMRGSNAILNFPLEVVCGSFKRRQVLPASSAKFSGGTSEI

Protein Length: 88

Fln nts: GCATTATAGAGGAGTTAGGAAGAGGCCCTGGGGAAAATACGCGGCGGAGATCCGAGATTCCACGAGGCACGGAGTTCGAGTCTGGTTGGGGACTTTTGAAACGGGGGAGGAGGCGGCCATGGCTTATGATCAGGCTGCCTTCGCCATGAGAGGCTCCAACGCGATTCTCAATTTCCCCCTTGAAGTTGTTTGCGGCTCCTTCAAACGCCGCCAGGTCCTTCCGGCTTCCAGCGCCAAATTCTCCGGCGGTACCTCTGAAATTT

Fln Alignment:

AllPine_a_rep_c66191___HYRGVRKRPWGKYAAEIRDSTRHGVRVWLGTFETGEEXXXXXXXXXXXMRGSNAILNFPLEV
A9NRQ5________________HYRGVRQRPWGKFAAEIRDSSRQGARVWLGTFTTAEEAALAYDRAAYKMRGSRALLNFPLEV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain