UniGene Name: sp_v3.0_unigene126383
Length: 225 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene126383
C |
Ace file of the UniGene sp_v3.0_unigene126383
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450-dependent fatty acid hydroxylase-like protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5VQX4_ORYSJ | - | - | 1.0e-22 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
| Sma3 | Cytochrome P450, putative | - | - | 3.395e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Unspecific monooxygenase. | EC:1.14.14.1 | - | 5.586e-20 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 5.586e-20 | % | |
| Sma3 | Steroid hormone biosynthesis | 00140 | 5.586e-20 | % | |
| Sma3 | Caffeine metabolism | 00232 | 5.586e-20 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 5.586e-20 | % | |
| Sma3 | Arachidonic acid metabolism | 00590 | 5.586e-20 | % | |
| Sma3 | Linoleic acid metabolism | 00591 | 5.586e-20 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 5.586e-20 | % | |
| Sma3 | Retinol metabolism | 00830 | 5.586e-20 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 5.586e-20 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 5.586e-20 | % | |
| Sma3 | Drug metabolism - other enzymes | 00983 | 5.586e-20 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 5.586e-20 | % | |
| Sma3 | Metabolic pathways | 01100 | 5.586e-20 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g27690; At2g27690/F15K20.21; At2g45510; CYP704A10; CYP94A13; CYP94A5; CYP94C5; CYP94C6; CYP94C7; CYP94C9; CYP94D22; CYP94D23v1; CYP94D23v2; GSVIVT00021650001; GSVIVT00022036001; GSVIVT00023301001; GSVIVT00026264001; GSVIVT00026267001; GSVIVT00026268001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008393 | Molecular Function | 0.0 | - | |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Histidine phosphatase superfamily, clade-1 | IPR013078 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G27690.1 | CYP94C1 cytochrome P450, family 94, subfamily C, polypeptide 1 chr2:11809373-11810860 FORWARD LENGTH=495 | 2.0e-24 | 56% |
| RefSeq | Arabidopsis thaliana | NP_180337.1 | cytochrome P450, family 94, subfamily C, polypeptide 1 [Arabidopsis thaliana] | 2.0e-24 | 56% |
| RefSeq | Populus trichocarpa | XP_002312905.1 | cytochrome P450 [Populus trichocarpa] | 4.0e-27 | 60% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A7Y6
Fln msg: Distance to subject end: 65 aas, your sequence is shorter than subject: 75 - 559
Fln protein:
P
Protein Length:
76
Fln nts:
C
Fln Alignment:
AllPine_a_c63754___PVLLYSRHALHNDVLPDGTFVGKGNRVTYHPYAMGRIDAMWGADCLHFKPERWMNEDGHFVPQSPFKFAVFHGG
D5A7Y6________________PVLLDSKHALHNDVLPDGTFVGKGTRVTYHPYAMGRMNAIWGADCLQFKPERWVNKDGHFVPQSPFKFAVFQGG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta