UniGene Name: sp_v3.0_unigene126053
Length: 213 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene126053
G |
Ace file of the UniGene sp_v3.0_unigene126053
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | PREDICTED: similar to putative serine/threonine protein kinase n=1 Tax=Vitis vinifera RepID=UPI00019841C9 | - | - | 5.0e-23 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Sma3 | Serine/threonine protein kinase, putative | - | - | 9.049e-33 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 1.276e-18 | - |
| Sma3 | Protein kinase C. | EC:2.7.11.13 | - | 1.144e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphatidylinositol signaling system | 04070 | 1.144e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | AGC1-10; AT4g13000; AT4g26610; ATPK64; AcNPH1; Adi3; At1g16440; At1g53700; At1g79250; At2g26700; At2g34650; At2g36350; At2g44830; At3g12690; At3g14370; At3g27580; At3g44610; At3g52890; At4g13000; At4g13000/F25G13_90; At4g26610; At5g03640; At5g40030; At5g4 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | G-protein coupled photoreceptor activity | GO:0008020 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | blue light photoreceptor activity | GO:0009882 | Molecular Function | 0.0 | - |
| Sma3 | FMN binding | GO:0010181 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | sensory perception | GO:0007600 | Biological Process | 0.0 | - |
| Sma3 | phototropism | GO:0009638 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | chloroplast relocation | GO:0009902 | Biological Process | 0.0 | - |
| Sma3 | auxin polar transport | GO:0009926 | Biological Process | 0.0 | - |
| Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of anion channel activity by blue light | GO:0010362 | Biological Process | 0.0 | - |
| Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
| Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | root hair initiation | GO:0048766 | Biological Process | 0.0 | - |
| Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
| Sma3 | cotyledon development | GO:0048825 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PAS | IPR000014 | - | 0.0 | - |
| Sma3 | PAS-associated, C-terminal | IPR000700 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | AGC-kinase, C-terminal | IPR000961 | - | 0.0 | - |
| Sma3 | Phytochrome | IPR001294 | - | 0.0 | - |
| Sma3 | PAC motif | IPR001610 | - | 0.0 | - |
| Sma3 | Zinc finger, RanBP2-type | IPR001876 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | GAF domain | IPR003018 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF591 | IPR007649 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Phytochrome, central region | IPR013515 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore binding site | IPR013516 | - | 0.0 | - |
| Sma3 | PAS fold-2 | IPR013654 | - | 0.0 | - |
| Sma3 | PAS fold-3 | IPR013655 | - | 0.0 | - |
| Sma3 | PAS fold | IPR013767 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore attachment domain | IPR016132 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G34650.1 | PID, ABR Protein kinase superfamily protein chr2:14589934-14591557 REVERSE LENGTH=438 | 2.0e-28 | 72% |
| RefSeq | Arabidopsis thaliana | NP_181012.1 | protein kinase-like protein [Arabidopsis thaliana] | 3.0e-28 | 72% |
| RefSeq | Populus trichocarpa | XP_002312901.1 | predicted protein [Populus trichocarpa] | 1.0e-28 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVL2
Fln msg: Distance to subject end: 237 aas, your sequence is shorter than subject: 70 - 506
Fln protein:
H
Protein Length:
71
Fln nts:
G
Fln Alignment:
AllPine_a_c63140___HSLCQQQLIKRFSLRATRFYAAEVLVALEYLHMMGVVFRDLKPENVLVREDGHIMLSDFDLSLRC
A9NVL2________________HTFRQRQPAKRFSEEAVRFYASEVLLALEYLHMMGVVYRDLKPENVLVREDGHIMLSDFDLSLRC

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta