|
||||||
|
UniGene Name: sp_v3.0_unigene125900
Length: 174 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene125900
G |
|
Ace file of the UniGene sp_v3.0_unigene125900
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Thioredoxin reductase n=1 Tax=Picea sitchensis RepID=B8LPW6_PICSI | - | - | 2.0e-25 | 96% |
| FL-Next | sp=Thioredoxin reductase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Sma3 | Thioredoxin reductase | - | - | 5.793e-39 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Thioredoxin-disulfide reductase. | EC:1.8.1.9 | - | 8.29569e-43 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyrimidine metabolism | 00240 | 8.29569e-43 | % | |
| Sma3 | Selenocompound metabolism | 00450 | 8.29569e-43 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g41680; CHLREDRAFT_78928; CvNTR-C; GSVIVT00025615001; MICPUCDRAFT_23559; NTRC; NTRC1; OSTLU_28227; Os07g0657900; OsI_27178; OsJ_25429; OsNtrC; Ot18g00250; PHYPADRAFT_173396; POPTRDRAFT_1080427; RCOM_1216280; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | thioredoxin-disulfide reductase activity | GO:0004791 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | removal of superoxide radicals | GO:0019430 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | Thioredoxin reductase | IPR005982 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR008255 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | IPR017936 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G41680.1 | NTRC NADPH-dependent thioredoxin reductase C chr2:17376349-17379028 REVERSE LENGTH=529 | 2.0e-22 | 67% |
| RefSeq | Arabidopsis thaliana | NP_565954.1 | NADPH-dependent thioredoxin reductase 3 [Arabidopsis thaliana] | 2.0e-22 | 67% |
| RefSeq | Populus trichocarpa | XP_002308935.1 | predicted protein [Populus trichocarpa] | 1.0e-27 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPW6
Fln msg: Distance to subject end: 329 aas, your sequence is shorter than subject: 58 - 562
Fln protein:
G
Protein Length:
59
Fln nts:
G
Fln Alignment:
AllPine_a_c62953___GPDFMDRMRRQAERWGAELFQEDVEHVDLKNRPFTIRSSEREVKCHSLIVATGATARR
B8LPW6________________GPDLMDRMRRQAERWGAELFQEDVEHVDLKNRPFTIRSSDREVKCHSLIVATGATARR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
