UniGene Name: sp_v3.0_unigene125801
Length: 229 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene125801
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Acetyl-CoA carboxylase n=7 Tax=rosids RepID=D2CFN2_9ROSI | - | - | 9.0e-18 | 69% |
FL-Next | sp=Acetyl-CoA carboxylase 1; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 62% |
Sma3 | Acetyl-CoA carboxylase | - | - | 9.203e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Acetyl-CoA carboxylase. | EC:6.4.1.2 | - | 2.542e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid biosynthesis | 00061 | 2.542e-09 | % | |
Sma3 | Tetracycline biosynthesis | 00253 | 2.542e-09 | % | |
Sma3 | Pyruvate metabolism | 00620 | 2.542e-09 | % | |
Sma3 | Propanoate metabolism | 00640 | 2.542e-09 | % | |
Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 2.542e-09 | % | |
Sma3 | Metabolic pathways | 01100 | 2.542e-09 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.542e-09 | % |
Source | Gene names |
---|---|
Sma3 | ACC-R; ACC-S; ACC1; ACCase; ACCase-A; ACCase-B; ACCg8; Acc-1; Acc-2; GSVIVT00015268001; LOC_Os10g21910; OSJNBa0073L01.2; OsI_19330; OsI_33225; OsJ_17935; OsJ_31236; PHYPADRAFT_115301; PHYPADRAFT_191193; POPTRDRAFT_559146; POPTRDRAFT_830215; RCOM_1033990; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | acetyl-CoA carboxylase activity | GO:0003989 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | biotin binding | GO:0009374 | Molecular Function | 0.0 | - |
Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carboxyl transferase | IPR000022 | - | 0.0 | - |
Sma3 | Biotin/lipoyl attachment | IPR000089 | - | 0.0 | - |
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | Biotin-binding site | IPR001882 | - | 0.0 | - |
Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
Sma3 | Carbamoyl-phosphate synthase, large subunit, N-terminal | IPR005481 | - | 0.0 | - |
Sma3 | Biotin carboxylase, C-terminal | IPR005482 | - | 0.0 | - |
Sma3 | ATP-grasp fold | IPR011761 | - | 0.0 | - |
Sma3 | Acetyl-coenzyme A carboxyltransferase, N-terminal | IPR011762 | - | 0.0 | - |
Sma3 | Acetyl-coenzyme A carboxyltransferase, C-terminal | IPR011763 | - | 0.0 | - |
Sma3 | Biotin carboxylation domain | IPR011764 | - | 0.0 | - |
Sma3 | Acetyl-CoA carboxylase, central domain | IPR013537 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 1 | IPR013815 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 2 | IPR013816 | - | 0.0 | - |
Sma3 | IPR013817 | - | 0.0 | - | |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G36160.1 | ACC1, AT-ACC1, EMB22, GK, PAS3 acetyl-CoA carboxylase 1 chr1:13534196-13543773 FORWARD LENGTH=2254 | 1.0e-16 | 77% |
RefSeq | Arabidopsis thaliana | NP_001185143.1 | acetyl-CoA carboxylase 1 [Arabidopsis thaliana] | 2.0e-16 | 77% |
RefSeq | Populus trichocarpa | XP_002306591.1 | predicted protein [Populus trichocarpa] | 7.0e-22 | 67% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: sp_plants
Fln subject: Q8S6N5
Fln msg: Distance to subject end: 2200 aas, W1: There is no M at the beginning, your sequence is shorter than subject: 67 - 2267
Fln protein:
Y
Protein Length:
68
Fln nts:
A
Fln Alignment:
AllPine_a_c62827___NGIANGKAEVRTSAVLSQIDEFCYALGGNKPIRSILIANNGMAAVKFMRSVRAWAYETY
Q8S6N5________________NGILNGMSNSRHPSSPSEVDEFCKALGGDSPIHSVLVANNGMAAVKFMRSIRTWALETF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain