UniGene Name: sp_v3.0_unigene125777
Length: 186 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene125777
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9T4Z1_RICCO | - | - | 6.0e-22 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
Sma3 | S-receptor kinase, putative | - | - | 8.196e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 3.937e-07 | - |
Sma3 | [Myosin light-chain] kinase. | EC:2.7.11.18 | - | 2.706e-08 | - |
Source | Gene names |
---|---|
Sma3 | 17L07.5; AT4g00340; AT4g32300; A_IG005I10.19; At1g34300; At2g19130; At4g32300; B1099D03.46; B1423D04.25; DUPR11.18; F10M6.60; F23M19.5; F5I10.19; F8B4.10; GSVIVT00000338001; GSVIVT00001733001; GSVIVT00001735001; GSVIVT00014888001; GSVIVT00014893001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | phospholipase C activity | GO:0004629 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G34300.1 | lectin protein kinase family protein chr1:12503450-12505939 FORWARD LENGTH=829 | 3.0e-26 | 76% |
RefSeq | Arabidopsis thaliana | NP_174690.1 | lectin protein kinase-like protein [Arabidopsis thaliana] | 4.0e-26 | 76% |
RefSeq | Populus trichocarpa | XP_002327224.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-29 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 182 aas, your sequence is shorter than subject: 62 - 431
Fln protein:
T
Protein Length:
63
Fln nts:
A
Fln Alignment:
AllPine_a_c62801___SLDNFLFASADDSSKKLDWDARFGIALGTARGITYLHEECRDCIIHCDIKPENILLDDNY
A9NM60________________SLDRWLF----DSDKWLDWKTRYSIALDTARGLAYLHEESRLCILHLDVKPQNILVDEYF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain