|
||||||
|
UniGene Name: sp_v3.0_unigene125766
Length: 241 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene125766
A |
|
Ace file of the UniGene sp_v3.0_unigene125766
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNA ligase n=1 Tax=Populus nigra RepID=Q0PCF8_POPNI | - | - | 1.0e-23 | 67% |
| FL-Next | sp=DNA ligase 4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 60% |
| Sma3 | DNA ligase | - | - | 3.617e-10 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA ligase (ATP). | EC:6.5.1.1 | - | 1.4e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g57160; GSVIVT00006793001; LIG4; MUL3.11; OSIGBa0113I13.3; OsI_17298; OsJ_16077; POPTRDRAFT_911613; PnLig4; RCOM_0440480; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | DNA ligase (ATP) activity | GO:0003910 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | DNA replication | GO:0006260 | Biological Process | 0.0 | - |
| Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
| Sma3 | double-strand break repair | GO:0006302 | Biological Process | 0.0 | - |
| Sma3 | DNA recombination | GO:0006310 | Biological Process | 0.0 | - |
| Sma3 | response to X-ray | GO:0010165 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA ligase, ATP-dependent | IPR000977 | - | 0.0 | - |
| Sma3 | BRCT domain | IPR001357 | - | 0.0 | - |
| Sma3 | DNA ligase, ATP-dependent, N-terminal | IPR012308 | - | 0.0 | - |
| Sma3 | DNA ligase, ATP-dependent, C-terminal | IPR012309 | - | 0.0 | - |
| Sma3 | DNA ligase, ATP-dependent, central | IPR012310 | - | 0.0 | - |
| Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
| Sma3 | DNA ligase, ATP-dependent, conserved site | IPR016059 | - | 0.0 | - |
| Sma3 | AT hook, DNA-binding motif | IPR017956 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G57160.1 | ATLIG4, LIG4 DNA ligase IV chr5:23155150-23161688 REVERSE LENGTH=1219 | 8.0e-27 | 60% |
| RefSeq | Arabidopsis thaliana | NP_568851.2 | DNA ligase 4 [Arabidopsis thaliana] | 1.0e-26 | 60% |
| RefSeq | Populus trichocarpa | XP_002325262.1 | predicted protein [Populus trichocarpa] | 1.0e-29 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LL84
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 460 aas, your sequence is shorter than subject: 80 - 1219
Fln protein:
M
Protein Length:
81
Fln nts:
A
Fln Alignment:
AllPine_a_c62788___HGGSFSMNLNDSVTHSVAADKRGIKYQAAVKHGDVIHYSWVIDCCKEKALLPLRPKYFLSLSELSKEKMKEDID
Q9LL84________________NGGKFSMNLNNSVTHCIAAESSGIKYQAAKRQRDVIHFSWVLDCCSRNKMLPLLPKYFLHLTDASRTKLQDDID
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
