UniGene Name: sp_v3.0_unigene125642
Length: 231 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene125642
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | phospholipid-translocating ATPase [Arabidopsis thaliana] sp|Q9SAF5.1|ALA11_ARATH RecName: Full=Putative phospholipid-transporting ATPase 11; Short=AtALA11; AltName: Full=Aminophospholipid flippase 11 gb|AAD31074.1|AC007357_23 Similar to gb|AF038007 FIC1 g | - | - | 2.0e-21 | 71% |
FL-Next | sp=Putative phospholipid-transporting ATPase 11; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 71% |
Sma3 | Aminophospholipid ATPase | - | - | 2.614e-18 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phospholipid-translocating ATPase. | EC:3.6.3.1 | - | 1.68156e-44 | - |
Source | Gene names |
---|---|
Sma3 | ALA1; ALA10; ALA11; ALA12; ALA4; ALA5; ALA6; ALA7; ALA8; ALA9; At1g13210; At1g17500; At1g26130; At1g54280; At1g68710; At1g72700; At3g13900; At3g25610; At3g27870; CHLREDRAFT_172401; F14G11.10; F1L3.21; F20D21.10; F24J5.6; F28B23.19; F28P22.11; F3F19.24; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | phospholipid-translocating ATPase activity | GO:0004012 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
Sma3 | phospholipid transport | GO:0015914 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
Sma3 | ATPase, P-type, phospholipid-translocating, flippase | IPR006539 | - | 0.0 | - |
Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
Sma3 | HAD superfamily hydrolase-like, type 3 | IPR013200 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G13210.1 | ACA.l autoinhibited Ca2+/ATPase II chr1:4509252-4513774 REVERSE LENGTH=1203 | 6.0e-27 | 71% |
RefSeq | Arabidopsis thaliana | NP_172780.1 | phospholipid-translocating ATPase [Arabidopsis thaliana] | 8.0e-27 | 71% |
RefSeq | Populus trichocarpa | XP_002303211.1 | predicted protein [Populus trichocarpa] | 4.0e-27 | 81% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SAF5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 338 aas, your sequence is shorter than subject: 76 - 1203
Fln protein:
*
Protein Length:
77
Fln nts:
A
Fln Alignment:
AllPine_a_c62643___MQVSSVRGNDDVFALIIDGNSLAYALEKEIKEKFLSVAIGCASVICCRVSPKQKALVTRLVKEGTGKTTLAIG
Q9SAF5________________LTASSSASSHEAFALIIDGKSLTYALEDDFKKKFLDLATGCASVICCRSSPKQKALVTRLVKSGTGKTTLAIG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain