|
||||||
|
UniGene Name: sp_v3.0_unigene125583
Length: 227 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene125583
A |
|
Ace file of the UniGene sp_v3.0_unigene125583
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9SIT7.1|PP151_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g13600 gb|AAD22682.1| hypothetical protein [Arabidopsis thaliana] gb|AEC06244.1| pentatricopeptide repe | - | - | 1.0e-21 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 9.027e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g03540; At1g32415; At1g77010; At2g01510; At2g03380; At2g03880; At2g13600; At2g40720; At3g46790; At3g49710; At3g53360; At4g02750; At4g16835; At4g33990; At5g13270; At5g19020; At5g56310; At5g66520; B1032F05.19; B1045D11.23; CRR2; DYW10; EMB2758; F17I5.180 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | polygalacturonase activity | GO:0004650 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
| Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
| Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oligopeptide transporter | IPR000109 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 28 | IPR000743 | - | 0.0 | - |
| Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Putative methylase | IPR004557 | - | 0.0 | - |
| Sma3 | Parallel beta-helix repeat | IPR006626 | - | 0.0 | - |
| Sma3 | Methyltransferase small | IPR007848 | - | 0.0 | - |
| Sma3 | IPR008512 | - | 0.0 | - | |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Pectin lyase fold | IPR012334 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G13600.1 | Pentatricopeptide repeat (PPR) superfamily protein chr2:5671493-5673586 FORWARD LENGTH=697 | 2.0e-27 | 62% |
| RefSeq | Arabidopsis thaliana | NP_178983.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-27 | 62% |
| RefSeq | Populus trichocarpa | XP_002314911.1 | predicted protein [Populus trichocarpa] | 6.0e-27 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 213 aas, your sequence is shorter than subject: 75 - 370
Fln protein:
C
Protein Length:
76
Fln nts:
A
Fln Alignment:
AllPine_a_c62576___LFEEMLKAGIKPNPVTFISVLSACSHAGLVDEGRYYFESMNRDHSITPSKDHYSCMIDILGRAGYLEEAEKF
A9P0W0________________LFEQMLQTGVKPNQITFVVVLSGCSHAGLVDEGRNYFDSMTRDHGISPKAEHYSCMVDLFGRAGCLDEALNF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
