UniGene Name: sp_v3.0_unigene125532
Length: 208 nt
UniGene Fasta |
---|
>sp_v3.0_unigene125532
A |
Ace file of the UniGene sp_v3.0_unigene125532 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | callose synthase 12 [Arabidopsis thaliana] sp|Q9ZT82.1|CALSC_ARATH RecName: Full=Callose synthase 12; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 5; AltName: Full=Protein POWDERY MILDEW RESISTANT 4 gb|AAD11597.1| put | - | - | 3.0e-16 | 74% |
FL-Next | sp=Callose synthase 12; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 74% |
Sma3 | 1,3-beta-glucan synthase | - | - | 6.535e-17 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 1,3-beta-glucan synthase. | EC:2.4.1.34 | - | 7.076e-30 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 7.076e-30 | % |
Source | Gene names |
---|---|
Sma3 | At2g31960; At2g36850; At3g14570; At4g03550; At4g04970; CALS10; CALS11; CALS12; CALS2; CALS8; CFL1; CalS3; CalS9; F22D22.29; F9H3.18; GSL1; GSL3; GSL4; GSL5; GSL8; GSVIVT00004069001; GSVIVT00009059001; GSVIVT00015898001; Gsl1; LOC_Os03g03610; MIE1.7; OJ101 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 1,3-beta-D-glucan synthase complex | GO:0000148 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | 1,3-beta-D-glucan synthase activity | GO:0003843 | Molecular Function | 0.0 | - |
Sma3 | (1->3)-beta-D-glucan biosynthetic process | GO:0006075 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | regulation of cell shape | GO:0008360 | Biological Process | 0.0 | - |
Sma3 | response to fungus | GO:0009620 | Biological Process | 0.0 | - |
Sma3 | salicylic acid mediated signaling pathway | GO:0009863 | Biological Process | 0.0 | - |
Sma3 | defense response signaling pathway, resistance gene-dependent | GO:0009870 | Biological Process | 0.0 | - |
Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
Sma3 | defense response by callose deposition | GO:0052542 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Glycosyl transferase, family 48 | IPR003440 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G03550.1 | ATGSL05, GSL05, ATGSL5, PMR4, GSL5 glucan synthase-like 5 chr4:1573513-1579195 FORWARD LENGTH=1780 | 6.0e-21 | 74% |
RefSeq | Arabidopsis thaliana | NP_192264.1 | callose synthase 12 [Arabidopsis thaliana] | 8.0e-21 | 74% |
RefSeq | Populus trichocarpa | XP_002330632.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 68% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9ZT82
Fln msg: Distance to subject end: 752 aas, your sequence is shorter than subject: 69 - 1780
Fln protein:
M
Protein Length:
70
Fln nts:
A
Fln Alignment:
AllPine_a_c62511___ELLTHKVVELRLWASYRGQTLARTVRGMMYYYKALKMFAFLDSASEVSIQNACQALAS
Q9ZT82________________ELWTTKLRDLRLWASYRGQTLARTVRGMMYYYRALKMLAFLDSASEMDIREGAQELGS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain