SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene125273

Length: 302 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene125273
ATTTATCACAGAGACATCAAAGCCACTAACATTCTGTTAGATGACGATATGAATGCTCGTGTTGCCGATTTTGGTTTGGCGAGGATCATGACTAAAGAAGATGCAGCAGAATCCCATTTGACAACAAGGGTAGCAGGTACGCACGGCTACTTGGCCCCCGAATATGCTCTCTACGGCCAACTCACAGATAAAAGTGATGTGTATAGCTTTGGGGTTCTGCTGTTGGAGATCATGAGCGGCAGAAAAGCTCTCGACACCACTGCCTCCCATTATCTCATAGCGGATTGGGCATGGGAGACATT

Ace file of the UniGene sp_v3.0_unigene125273 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Protein kinase n=4 Tax=Andropogoneae RepID=B6SY15_MAIZE	-	-	6.0e-35	77%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	83%
Sma3	ATP binding protein, putative	-	-	8.681e-13	-

Source	ECs	Term	Type	e value	Identity
Sma3	Non-specific protein-tyrosine kinase.	EC:2.7.10.2	-	1.095e-06	-
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	6.148e-07	-

Source	Gene names
Sma3	APK2a; AT1G07650; AT1G29720; AT1G53430; AT1G53440; AT3G14840; AT4g32710; At1g11050; At1g14370; At1g14370/F14L17.14; At1g16670; At1g29720; At1g29730; At1g68690; At1g70450; At1g70460; At2g28590; At2g42960; At2g48010; At3g59110; At4g23130; At4g23180; At4g232

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3	metal ion transmembrane transporter activity	GO:0046873	Molecular Function	-
Sma3	DNA methylation	GO:0006306	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	metal ion transport	GO:0030001	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	RNA recognition motif domain	IPR000504	-	-
Sma3	Zinc finger, CCCH-type	IPR000571	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Bromo adjacent homology (BAH) domain	IPR001025	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	C-5 cytosine methyltransferase	IPR001525	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Alpha-isopropylmalate/homocitrate synthase, conserved site	IPR002034	-	-
Sma3	Transcription factor, MADS-box	IPR002100	-	-
Sma3	Chaperonin TCP-1, conserved site	IPR002194	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	Mg2+ transporter protein, CorA-like/Zinc transport protein ZntB	IPR002523	-	-
Sma3	Gnk2-homologous domain	IPR002902	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Nucleotide-binding, alpha-beta plait	IPR012677	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	SKG6/AXL2 alpha-helix transmembrane domain	IPR014805	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	Homeobox, conserved site	IPR017970	-	-
Sma3	DNA methylase, C-5 cytosine-specific, active site	IPR018117	-	-
Sma3	Beta-ketoacyl synthase, active site	IPR018201	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G11050.1	Protein kinase superfamily protein chr1:3681892-3683769 FORWARD LENGTH=625	1.99965e-42	74%
RefSeq	Arabidopsis thaliana	NP_172572.1	putative receptor-like protein kinase [Arabidopsis thaliana]	1.99965e-42	74%
RefSeq	Populus trichocarpa	XP_002306651.1	predicted protein [Populus trichocarpa]	6.99949e-42	73%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5ACH5

Fln msg: Distance to subject end: 98 aas, your sequence is shorter than subject: 100 - 246

Fln protein: IYHRDIKATNILLDDDMNARVADFGLARIMTKEDAAESHLTTRVAGTHGYLAPEYALYGQLTDKSDVYSFGVLLLEIMSGRKALDTTASHYLIADWAWET

Protein Length: 101

Fln nts: ATTTATCACAGAGACATCAAAGCCACTAACATTCTGTTAGATGACGATATGAATGCTCGTGTTGCCGATTTTGGTTTGGCGAGGATCATGACTAAAGAAGATGCAGCAGAATCCCATTTGACAACAAGGGTAGCAGGTACGCACGGCTACTTGGCCCCCGAATATGCTCTCTACGGCCAACTCACAGATAAAAGTGATGTGTATAGCTTTGGGGTTCTGCTGTTGGAGATCATGAGCGGCAGAAAAGCTCTCGACACCACTGCCTCCCATTATCTCATAGCGGATTGGGCATGGGAGACATT

Fln Alignment:

AllPine_a_c62174___IYHRDIKATNILLDDDMNARVADFGLARIMTKEDAAESHLTTRVAGTHGYLAPEYALYGQLTDKSDVYSFGVLLLEIMSGRKALDTTAS---HYLIADWAW
D5ACH5________________IYHRDIKPTNILLDDEMNAFVADFGLARMMTK--GGESHITTKVAGTHGYLAPEYALYGQLTDKSDVYSFGVLLLEIMSGRKALDTSGKSVPHYLITDWAW

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain