|
||||||
|
UniGene Name: sp_v3.0_unigene125171
Length: 194 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene125171
A |
|
Ace file of the UniGene sp_v3.0_unigene125171
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MDR-like ABC transporter [Catharanthus roseus] | - | - | 9.0e-16 | 67% |
| FL-Next | tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew). | - | - | 0.0 | 65% |
| Sma3 | Multidrug resistance protein 1, 2, putative | - | - | 1.364e-23 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphate-transporting ATPase. | EC:3.6.3.27 | - | 5.244e-17 | - |
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 1.272e-19 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g02520; At1g02530; At2g47000; At3g62150; At4g01820; At4g01830; At4g18050; At5g46540; Cjmdr1; F14M4.17; F15J5.20; GSVIVT00003365001; GSVIVT00003367001; GSVIVT00003375001; GSVIVT00003377001; GSVIVT00019727001; GSVIVT00019729001; GSVIVT00028243001; K11I1. |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
| Sma3 | auxin efflux | GO:0010315 | Biological Process | 0.0 | - |
| Sma3 | basipetal auxin transport | GO:0010540 | Biological Process | 0.0 | - |
| Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
| Sma3 | IPR013596 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G02520.1 | PGP11 P-glycoprotein 11 chr1:524134-528745 FORWARD LENGTH=1278 | 4.0e-20 | 73% |
| RefSeq | Arabidopsis thaliana | NP_171753.1 | P-glycoprotein 11 [Arabidopsis thaliana] | 5.0e-20 | 73% |
| RefSeq | Populus trichocarpa | XP_002320939.1 | multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] | 3.0e-22 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E6Y0T0
Fln msg: Distance to subject end: 1113 aas, your sequence is shorter than subject: 64 - 1316
Fln protein:
R
Protein Length:
65
Fln nts:
A
Fln Alignment:
AllPine_a_c62051___VSGVCLKNYSKAGYCIFDSETSTGEVIGRMSGDTVLIQDAMGEKVGKFIQLMSTFIGGFVV
E6Y0T0________________IRSLYLKTILRQDIGFFDSEASTGEVIGRMSGDTILIQDAMGEKVGKFIQFITTFIAGFVI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
