UniGene Name: sp_v3.0_unigene125132
Length: 228 nt
UniGene Fasta |
---|
>sp_v3.0_unigene125132
A |
Ace file of the UniGene sp_v3.0_unigene125132 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Cycas revoluta RepID=Q4JQ46_CYCRE | - | - | 6.0e-23 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 9.36e-31 | - |
Source | Gene names |
---|---|
Sma3 | At2g15650; At2g17490; B1110B01.4; B1130H05.2; B1248C03.4; F11I4_21; Fourf gag/pol; GagPol1; H0211A12.10; H0306F03.15; H0413E07.4; H0512B01.3; H0512B01.8; LAFR2; LOC_Os03g02500; LOC_Os03g05850; LOC_Os03g11850; LOC_Os03g13700; LOC_Os03g20690; LOC_Os03g26290 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | GPI anchor biosynthetic process | GO:0006506 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 199 aas, your sequence is shorter than subject: 76 - 363
Fln protein:
I
Protein Length:
77
Fln nts:
A
Fln Alignment:
AllPine_a_c61998___IHQMDVKSAFLNGDLKEEVYLVQPEGFVKHGQEHLVCRLRKALYGLKQAPRSWYVKIDTFFLQNGFVKSKNEPT
B8LKV8________________VYQMDVKSAFLNGYLEEEVYVQQPPRYEVRGQEDKVYRLKKALNGLKQAPRAWYSKIDSYMIKNEFIRSTSEPT
SNPs (tot: 3) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
105 | 66 | 33 | 0.997454 | ||
120 | 66 | 33 | 0.997476 | ||
147 | 33 | 66 | 0.997467 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain