UniGene Name: sp_v3.0_unigene124908
Length: 204 nt
UniGene Fasta |
---|
>sp_v3.0_unigene124908
C |
Ace file of the UniGene sp_v3.0_unigene124908 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phd finger protein, putative n=1 Tax=Ricinus communis RepID=B9SP39_RICCO | - | - | 3.0e-17 | 75% |
FL-Next | sp=Histone-lysine N-methyltransferase ATX2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 67% |
Sma3 | SET domain protein | - | - | 7.86e-06 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histone-lysine N-methyltransferase. | EC:2.1.1.43 | - | 2.761e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lysine degradation | 00310 | 2.761e-08 | % |
Source | Gene names |
---|---|
Sma3 | ATX1; ATX2; At1g05830; At2g31630; At2g31650; GSVIVT00005671001; Os09g0134500; OsI_30479; OsJ_28463; P0406E03.49-1; POPTRDRAFT_246366; POPTRDRAFT_755956; RCOM_0617250; SDG27; SDG30; SDG937; SDG938; SET27; SET30; T20M3.10; T9H9.17; TRX1; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | phosphatidylinositol-5-phosphate binding | GO:0010314 | Molecular Function | 0.0 | - |
Sma3 | histone-lysine N-methyltransferase activity | GO:0018024 | Molecular Function | 0.0 | - |
Sma3 | diacylglycerol binding | GO:0019992 | Molecular Function | 0.0 | - |
Sma3 | histone methyltransferase activity (H3-K4 specific) | GO:0042800 | Molecular Function | 0.0 | - |
Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
Sma3 | regulation of flower development | GO:0009909 | Biological Process | 0.0 | - |
Sma3 | specification of floral organ identity | GO:0010093 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | histone H3-K4 methylation | GO:0051568 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | PWWP | IPR000313 | - | 0.0 | - |
Sma3 | SET domain | IPR001214 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | Protein kinase C-like, phorbol ester/diacylglycerol binding | IPR002219 | - | 0.0 | - |
Sma3 | Post-SET domain | IPR003616 | - | 0.0 | - |
Sma3 | FY-rich, N-terminal | IPR003888 | - | 0.0 | - |
Sma3 | FY-rich, C-terminal | IPR003889 | - | 0.0 | - |
Sma3 | IPR018351 | - | 0.0 | - | |
Sma3 | FY-rich, C-terminal subgroup | IPR018516 | - | 0.0 | - |
Sma3 | FY-rich, N-terminal subgroup | IPR018518 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G05830.1 | ATX2, SDG30 trithorax-like protein 2 chr1:1754452-1761225 FORWARD LENGTH=1083 | 2.0e-18 | 67% |
RefSeq | Arabidopsis thaliana | NP_001077464.4 | histone-lysine N-methyltransferase ATX2 [Arabidopsis thaliana] | 2.0e-18 | 67% |
RefSeq | Populus trichocarpa | XP_002301643.1 | SET domain protein [Populus trichocarpa] | 2.0e-21 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: sp_plants
Fln subject: P0CB22
Fln msg: your sequence is shorter than subject: 59 - 1083
Fln protein:
Q
Protein Length:
60
Fln nts:
C
Fln Alignment:
AllPine_a_c61713___QWEELTYDYRFFSIDEQLACYCGFPRCRGIVN-MDDEEQVGKIRVPRRELIAW
P0CB22________________KWEELTYDYRFFSIDERLACYCGFPRCRGVVNDTEAEERQANIHASRCELKEW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain