UniGene Name: sp_v3.0_unigene124838
Length: 166 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene124838
A |
Ace file of the UniGene sp_v3.0_unigene124838
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative aspartate kinase, homoserine dehydrogenase [Oryza sativa Japonica Group] | - | - | 2.0e-10 | 69% |
| FL-Next | sp=Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic; Zea mays (Maize). | - | - | 0.0 | 67% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Homoserine dehydrogenase. | EC:1.1.1.3 | - | 9.024e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 9.024e-07 | % | |
| Sma3 | Cysteine and methionine metabolism | 00270 | 9.024e-07 | % | |
| Sma3 | Lysine biosynthesis | 00300 | 9.024e-07 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 9.024e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 9.024e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.024e-07 | % | |
| Sma3 | Aspartate kinase. | EC:2.7.2.4 | - | 1.458e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 1.458e-06 | % | |
| Sma3 | Cysteine and methionine metabolism | 00270 | 1.458e-06 | % | |
| Sma3 | Lysine biosynthesis | 00300 | 1.458e-06 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 1.458e-06 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 1.458e-06 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.458e-06 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.458e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | AK-HSDH; AKHSDH1; OJ1790_D02.29-1; OJ1790_D02.29-2; Os08g0342400; OsI_28878; OsJ_26972; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | aspartate kinase activity | GO:0004072 | Molecular Function | 0.0 | - |
| Sma3 | homoserine dehydrogenase activity | GO:0004412 | Molecular Function | 0.0 | - |
| Sma3 | amino acid binding | GO:0016597 | Molecular Function | 0.0 | - |
| Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
| Sma3 | cellular amino acid biosynthetic process | GO:0008652 | Biological Process | 0.0 | - |
| Sma3 | aspartate family amino acid biosynthetic process | GO:0009067 | Biological Process | 0.0 | - |
| Sma3 | methionine biosynthetic process | GO:0009086 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aspartate/glutamate/uridylate kinase | IPR001048 | - | 0.0 | - |
| Sma3 | Aspartate kinase domain | IPR001341 | - | 0.0 | - |
| Sma3 | Homoserine dehydrogenase, catalytic | IPR001342 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Amino acid-binding ACT | IPR002912 | - | 0.0 | - |
| Sma3 | Aspartate/homoserine dehydrogenase, NAD-binding | IPR005106 | - | 0.0 | - |
| Sma3 | Bifunctional aspartokinase/homoserine dehydrogenase I | IPR011147 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Aspartate kinase, conserved site | IPR018042 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G19710.2 | - | 1.0e-13 | 65% |
| RefSeq | Arabidopsis thaliana | NP_193706.2 | bifunctional aspartokinase/homoserine dehydrogenase 1 [Arabidopsis thaliana] | 1.0e-13 | 65% |
| RefSeq | Populus trichocarpa | XP_002327390.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-14 | 55% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P49079
Fln msg: Distance to subject end: 626 aas, your sequence is shorter than subject: 54 - 920
Fln protein:
C
Protein Length:
55
Fln nts:
A
Fln Alignment:
AllPine_a_c61627___REVLVVNPTSSNQADPDYAASEENLNKWYSHTPAKTIIATGFM
P49079________________REVLVVNPSGANQVDPDYLESEKRLEKWFSRCPAETIIATGFI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta