|
||||||
|
UniGene Name: sp_v3.0_unigene124749
Length: 163 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene124749
G |
|
Ace file of the UniGene sp_v3.0_unigene124749 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Myosin class 11-2 n=1 Tax=Adiantum capillus-veneris RepID=Q5NTX0_ADICA | - | - | 1.0e-20 | 86% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 82% |
| Sma3 | Myosin XI, putative | - | - | 1.077e-15 | - |
| Source | Gene names |
|---|---|
| Sma3 | 41C02.1; AT4g33200; At1g17580; At2g31900; At4g28710; At4g33200; At5g20490; At5g43900; CHLREDRAFT_185104; F16A16.180; F20D22.7; F4I10.130; GSVIVT00003703001; GSVIVT00007440001; GSVIVT00009570001; GSVIVT00016505001; GSVIVT00020400001; GSVIVT00027094001; GSV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
| Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
| Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
| Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
| Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
| Sma3 | keratinization | GO:0031424 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G54560.1 | XIE, ATXIE Myosin family protein with Dil domain chr1:20371649-20379745 REVERSE LENGTH=1529 | 1.0e-24 | 84% |
| RefSeq | Arabidopsis thaliana | NP_175858.1 | Myosin family protein with Dil domain [Arabidopsis thaliana] | 2.0e-24 | 84% |
| RefSeq | Populus trichocarpa | XP_002319092.1 | predicted protein [Populus trichocarpa] | 2.0e-24 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6I3M8
Fln msg: Distance to subject end: 92 aas, your sequence is shorter than subject: 53 - 330
Fln protein:
K
Protein Length:
54
Fln nts:
G
Fln Alignment:
AllPine_a_c61509___LRANHVPPLLVCKLFTQVFSFINVQLFNSLLLRRECCSFSNGEYIKSGLAEL
F6I3M8________________MKANHVPPFVVCKVFTQIFSFINVQLFNSLLLRRECCSFSNGEFVKTGLAEL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
