|
||||||
|
UniGene Name: sp_v3.0_unigene124651
Length: 199 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene124651
A |
|
Ace file of the UniGene sp_v3.0_unigene124651
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative patatin [Oryza sativa Japonica Group] gb|EAZ07352.1| hypothetical protein OsI_29602 [Oryza sativa Indica Group] gb|EAZ43081.1| hypothetical protein OsJ_27671 [Oryza sativa Japonica Group] | - | - | 1.0e-21 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Sma3 | Patatin-like protein | - | - | 3.264e-35 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on ester bonds, Carboxylic ester hydrolases. | EC:3.1.1.- | - | 3.417e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 3.417e-11 | % | |
| Sma3 | Bisphenol degradation | 00363 | 3.417e-11 | % | |
| Sma3 | Glycerophospholipid metabolism | 00564 | 3.417e-11 | % | |
| Sma3 | Toluene degradation | 00623 | 3.417e-11 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 3.417e-11 | % | |
| Sma3 | Retinol metabolism | 00830 | 3.417e-11 | % | |
| Sma3 | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 3.417e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4g37050; AT4g37060; AT4g37070; At2g26560; At2g26560/T9J22.23; At4g37060; At4g37070; At5g43590; C7A10.290; C7A10.300; C7A10.310; GSVIVT00009696001; GSVIVT00009697001; GSVIVT00014769001; GSVIVT00014771001; GSVIVT00014773001; GSVIVT00014774001; GSVIVT00014 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | phospholipase A2 activity | GO:0004623 | Molecular Function | 0.0 | - |
| Sma3 | lipase activity | GO:0016298 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
| Sma3 | nutrient reservoir activity | GO:0045735 | Molecular Function | 0.0 | - |
| Sma3 | galactolipase activity | GO:0047714 | Molecular Function | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
| Sma3 | lipid catabolic process | GO:0016042 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Xylose isomerase | IPR001998 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Patatin/Phospholipase A2-related | IPR002641 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Xylose isomerase-like, TIM barrel domain | IPR013022 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26560.1 | PLP2, PLA IIA, PLA2A phospholipase A 2A chr2:11293912-11295708 REVERSE LENGTH=407 | 3.0e-25 | 68% |
| RefSeq | Arabidopsis thaliana | NP_180224.1 | phospholipase A 2A [Arabidopsis thaliana] | 4.0e-25 | 68% |
| RefSeq | Populus trichocarpa | XP_002301194.1 | predicted protein [Populus trichocarpa] | 8.0e-26 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NVZ8
Fln msg: Distance to subject end: 332 aas, atg_distance in limit (1-15): atg_distance = 6, W2: There is no M at the beginning, your sequence is shorter than subject: 66 - 403
Fln protein:
S
Protein Length:
67
Fln nts:
A
Fln Alignment:
AllPine_a_c61399___SIQGGGVRGIIPATILQFLERKLQGIDGPNVRIADYFDIIAGTSTGGLIAAMLTLPNEEKRPQFTA
A9NVZ8________________SIDGGGVRGIIPATILQFLEKKLQEFDGPDARIADYFDIIAGTSTGGLITAMLTAPNDKKRPLFAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
