UniGene Name: sp_v3.0_unigene124649
Length: 195 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene124649
G |
Ace file of the UniGene sp_v3.0_unigene124649 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pentatricopeptide repeat n=1 Tax=Eutrema parvulum RepID=E5F734_9BRAS | - | - | 2.0e-18 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
Sma3 | Pentatricopeptide, putative, expressed | - | - | 3.536e-13 | - |
Source | Gene names |
---|---|
Sma3 | At1g06140; At1g74630; At2g22070; At3g11460; At3g15130; At3g28660; At4g13650; At4g16835; At5g08510; At5g15300; At5g43790; At5g66520; DYW10; F18A5.40; F1M20.31; F24K9.13; F4B12.1; F8L15.21; F8M21_190; FCAALL.441; GSVIVT00000138001; GSVIVT00000293001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF221 | IPR003864 | - | 0.0 | - |
Sma3 | Zinc finger, TTF-type | IPR006580 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G66520.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr5:26551879-26553741 FORWARD LENGTH=620 | 3.0e-23 | 65% |
RefSeq | Arabidopsis thaliana | NP_201453.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 4.0e-23 | 65% |
RefSeq | Populus trichocarpa | XP_002320193.1 | predicted protein [Populus trichocarpa] | 1.0e-23 | 64% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: STOP codon was not found. Distance to subject end: 10 aas, your sequence is shorter than subject: 64 - 232
Fln protein:
S
Protein Length:
65
Fln nts:
G
Fln Alignment:
AllPine_a_c61397___SREYDISPTVEHYCCMVDLLGRAGQLKEAQDFIYKMPIKPNATVWLSLLGACRIHTNVELGE
D5AB53________________SVDYHITPVMEHYCCMVDLLGRTGCLDEAHDFINKMPIEPDTAVWQSLLGACRTHANVDLGE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain