SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene124398

Length: 367 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene124398
GTGGCCATTAAAAGGGCTAAAAAAGGGTCAATCCAGGGTGGATCCGGATTCAAAAACGAGGTCGAGCTCCTGTCTCGAGTTCACCATAAGAACCTGGTGGGACTCGTTGGTTTTTGCTTTGAACAAGAAGAACAGATGCTTGTTTATGAGTACATCCCAAATGGAACTCTAGGAGAAAGTCTCTCTGGTAAAACGGGTATTCGCCTGGACTGGGGAAGAAGAGTTCGTATAGCCCTAGGGTCTGCTCGAGGATTGGCATATCTGCACGAACTTGCAGATCCACCAATAATCCACAGAGACATCAAAACAGCCAACATATTGTTGGACATGAATCTGACTGCCAAGGTAGCAGACTTTGGGCTTTCCA

Ace file of the UniGene sp_v3.0_unigene124398 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] dbj\|BAC42504.1\| unknown protein [Arabidopsis thaliana] gb\|ACN59279.1\| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gb\|AEE36273.1\| leucine-rich repeat protein	-	-	0.0	79%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	59%
Sma3	Leucine-rich repeat receptor-like protein kinase	-	-	1.928e-20	-

Source	ECs	Term	Type	e value	Identity
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	8.104e-10	-
Sma3		EC:2.7.11.3-	-	8.461e-07	-

Source	Gene names
Sma3	AT1G51810; AT1G51820; AT1G51880; AT1G79620; AT2G28960; AT2G28970; AT2G28990; AT3G21340; AT3G24550; AT4g29990; AT4g32710; AT4g34440; AT5G37450; AT5G49760; AT5G49770; AT5G59650; AT5G59670; AT5G59680; At1g26150; At1g49270; At1g51810; At1g52290; At1g70460; At

Source	GOs	Term	Type	Identity
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to plasma membrane	GO:0005887	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	peptidyl-prolyl cis-trans isomerase activity	GO:0003755	Molecular Function	-
Sma3	protein kinase activity	GO:0004672	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	structural constituent of cell wall	GO:0005199	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	protein folding	GO:0006457	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	protein autophosphorylation	GO:0046777	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3	ATPase, F0 complex, subunit A	IPR000568	-	-
Sma3	RNA polymerase II, heptapeptide repeat, eukaryotic	IPR000684	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Peptidyl-prolyl cis-trans isomerase, FKBP-type, domain	IPR001179	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	TNFR/CD27/30/40/95 cysteine-rich region	IPR001368	-	-
Sma3	Myosin head, motor domain	IPR001609	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Dilute	IPR002710	-	-
Sma3	Gnk2-homologous domain	IPR002902	-	-
Sma3	Argonaute/Dicer protein, PAZ	IPR003100	-	-
Sma3	Stem cell self-renewal protein Piwi	IPR003165	-	-
Sma3	Pistil-specific extensin-like protein	IPR003882	-	-
Sma3	Myosin, N-terminal, SH3-like	IPR004009	-	-
Sma3	2Fe-2S ferredoxin, iron-sulphur binding site	IPR006058	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Uncharacterised protein family UPF0197	IPR007915	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Regulator of chromosome condensation/beta-lactamase-inhibitor protein II	IPR009091	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	SKG6/AXL2 alpha-helix transmembrane domain	IPR014805	-	-
Sma3	Domain of unknown function DUF1785	IPR014811	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Homeobox, conserved site	IPR017970	-	-
Sma3	Dil domain	IPR018444	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT1G79620.1	Leucine-rich repeat protein kinase family protein chr1:29957633-29962174 REVERSE LENGTH=971	79%
RefSeq	Arabidopsis thaliana	NP_178080.2	leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana]	79%
RefSeq	Populus trichocarpa	XP_002326254.1	predicted protein [Populus trichocarpa]	86%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5A9B2

Fln msg: Distance to subject end: 140 aas, your sequence is shorter than subject: 122 - 338

Fln protein: VAIKRAKKGSIQGGSGFKNEVELLSRVHHKNLVGLVGFCFEQEEQMLVYEYIPNGTLGESLSGKTGIRLDWGRRVRIALGSARGLAYLHELADPPIIHRDIKTANILLDMNLTAKVADFGLS

Protein Length: 123

Fln nts: GTGGCCATTAAAAGGGCTAAAAAAGGGTCAATCCAGGGTGGATCCGGATTCAAAAACGAGGTCGAGCTCCTGTCTCGAGTTCACCATAAGAACCTGGTGGGACTCGTTGGTTTTTGCTTTGAACAAGAAGAACAGATGCTTGTTTATGAGTACATCCCAAATGGAACTCTAGGAGAAAGTCTCTCTGGTAAAACGGGTATTCGCCTGGACTGGGGAAGAAGAGTTCGTATAGCCCTAGGGTCTGCTCGAGGATTGGCATATCTGCACGAACTTGCAGATCCACCAATAATCCACAGAGACATCAAAACAGCCAACATATTGTTGGACATGAATCTGACTGCCAAGGTAGCAGACTTTGGGCTTTCCA

Fln Alignment:

AllPine_a_c61082___VAIKRAKKGSIQGGSGFKNEVELLSRVHHKNLVGLVGFCFEQEEQMLVYEYIPNGTLGESLSGKTGIRLDWGRRVRIALGSARGLAYLHELADPPIIHRDIKTANILLDMNLTAKVADFGLS
D5A9B2________________VAIKRGEQGSMLWKVGFRSEIELLSRFHHNNVLDLIGFCVERGERMLVYNYIPNGSVNDILLGKKEIQLDWGSRVRIALGSARALEYLHYDVNPRVIHRNIKSTNILVDDYLTAKVAHFDLA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain