SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene124289

Length: 351 nt

UniGene Fasta

>sp_v3.0_unigene124289
CGTCGTGACCTTGGCTGTCACTCATTTCTACGTTTCATAAGATGCAGAAGGCTGGCGTAAAACCAGACCATATCACTTTCGTCGGTGTTCTGTCCGCATGCAGTCAGGGAGGCTTAATCCACGAAGGTTGGCAATACTTTGATTGCATGAAGAAAAACTATAACATCACACCTCGCCTGGAGCACTATGCCTGTATGGTTGATCTTCTCGGCCGTGCTGGACAACTCAATGAAGCATATGGCTTCATAAAGTCTATGCCATTAGAACCTGATGCATCTATATGGGGTTCCTTGCTTGGTGCATGCAGAGTCCATTGCAATACAGAGTTAGGACAACATGCAGCAGAACATC

Ace file of the UniGene sp_v3.0_unigene124289

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Unassigned protein	-	-	0.0	-
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	63%
Sma3	Pentatricopeptide repeat-containing protein, putative	-	-	3.5e-14	-

Source	Gene names
Sma3	At1g06140; At1g20230; At2g01510; At2g13600; At2g22070; At2g22410; At2g40720; At3g24000; At3g49140; At3g49170; At4g01030; At4g02750; At4g19191; At4g33990; At5g08510; At5g15300; At5g40410; At5g66520; EMB2261; EMB2758; F14M13.19; F14O13.19; F17I5.180; F2I9.1

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	ubiquitin thiolesterase activity	GO:0004221	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	deaminase activity	GO:0019239	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	purine ribonucleoside monophosphate biosynthetic process	GO:0009168	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	RNA metabolic process	GO:0016070	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Armadillo	IPR000225	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Adenosine/AMP deaminase domain	IPR001365	-	-
Sma3	Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1	IPR001578	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	MIF4G-like, type 3	IPR003890	-	-
Sma3	Initiation factor eIF-4 gamma, MA3	IPR003891	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Armadillo-like helical	IPR011989	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Methyltransferase type 11	IPR013216	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Thioredoxin, conserved site	IPR017937	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G40410.1	Tetratricopeptide repeat (TPR)-like superfamily protein chr5:16171385-16173211 FORWARD LENGTH=608	1.0e-39	57%
RefSeq	Arabidopsis thaliana	NP_198857.2	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	1.0e-39	57%
RefSeq	Populus trichocarpa	XP_002305733.1	predicted protein [Populus trichocarpa]	8.99998e-41	54%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5ADG9

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 178 aas, your sequence is shorter than subject: 116 - 312

Fln protein: S*PWLSLISTFHKMQKAGVKPDHITFVGVLSACSQGGLIHEGWQYFDCMKKNYNITPRLEHYACMVDLLGRAGQLNEAYGFIKSMPLEPDASIWGSLLGACRVHCNTELGQHAAEH

Protein Length: 117

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTTCTACGTTTCATAAGATGCAGAAGGCTGGCGTAAAACCAGACCATATCACTTTCGTCGGTGTTCTGTCCGCATGCAGTCAGGGAGGCTTAATCCACGAAGGTTGGCAATACTTTGATTGCATGAAGAAAAACTATAACATCACACCTCGCCTGGAGCACTATGCCTGTATGGTTGATCTTCTCGGCCGTGCTGGACAACTCAATGAAGCATATGGCTTCATAAAGTCTATGCCATTAGAACCTGATGCATCTATATGGGGTTCCTTGCTTGGTGCATGCAGAGTCCATTGCAATACAGAGTTAGGACAACATGCAGCAGAACATC

Fln Alignment:

AllPine_a_c60930___FHKMQKAGVKPDHITFVGVLSACSQGGLIHEGWQYFDCMKKNYNITPRLEHYACMVDLLGRAGQLNEAYGFIKSMPLEPDASIWGSLLGACRVHCNTELGQHAAE
D5ADG9________________FTQMQQRGVKPNEITFISVLSACSHAGLVDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFIEKMPIEPGASVWGAFLGSCRIHCNIELGERVAE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain