UniGene Name: sp_v3.0_unigene124133
Length: 97 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene124133
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative auxin response factor 5/7 (Fragment) n=1 Tax=Gnetum gnemon RepID=E1UHX8_GNEGN | - | - | 2.0e-09 | 90% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | Auxin response factor, putative | - | - | 1.039e-14 | - |
Source | Gene names |
---|---|
Sma3 | ARF12; ARF16; ARF17; ARF19; ARF2; ARF21; ARF25; ARF5; ARF6; ARF6A; ARF6B; ARF7; ARF7A; ARF7B; ARF8; At1g19220; At1g19850; At1g30330; At5g20730; At5g37020; BIP; CsARF1; CsARF2; CsARF3; F6F9.10; FWF; GSVIVT00014459001; GSVIVT00016396001; GSVIVT00017021001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
Sma3 | phototropism | GO:0009638 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to hormone stimulus | GO:0009725 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | blue light signaling pathway | GO:0009785 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
Sma3 | lateral root primordium development | GO:0010386 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Sma3 | meristem development | GO:0048507 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
Sma3 | AUX/IAA protein | IPR003311 | - | 0.0 | - |
Sma3 | B3 DNA binding domain | IPR003340 | - | 0.0 | - |
Sma3 | Auxin response factor | IPR010525 | - | 0.0 | - |
Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G37020.1 | ARF8, ATARF8 auxin response factor 8 chr5:14630151-14634106 FORWARD LENGTH=811 | 1.0e-11 | 81% |
RefSeq | Arabidopsis thaliana | NP_001078672.1 | auxin response factor 8 [Arabidopsis thaliana] | 1.0e-11 | 81% |
RefSeq | Populus trichocarpa | XP_002307574.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-13 | 84% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRW7
Fln msg: Distance to subject end: 539 aas, your sequence is shorter than subject: 32 - 920
Fln protein:
E
Protein Length:
33
Fln nts:
G
Fln Alignment:
AllPine_a_c60662___ETEESSVRRYMGTIAGISPLDPVRWPKSQWRN
B8LRW7________________ETEDATERRYTGTIVGIGDVDPMRWPNSEWRS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain