SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene124133

Length: 97 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene124133
GAAACTGAGGAGTCCAGTGTACGCAGGTATATGGGTACCATTGCAGGAATTAGTCCTCTTGATCCTGTGCGATGGCCAAAGTCACAGTGGCGTAATC

Ace file of the UniGene sp_v3.0_unigene124133 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Putative auxin response factor 5/7 (Fragment) n=1 Tax=Gnetum gnemon RepID=E1UHX8_GNEGN	-	-	2.0e-09	90%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	59%
Sma3	Auxin response factor, putative	-	-	1.039e-14	-

Source	Gene names
Sma3	ARF12; ARF16; ARF17; ARF19; ARF2; ARF21; ARF25; ARF5; ARF6; ARF6A; ARF6B; ARF7; ARF7A; ARF7B; ARF8; At1g19220; At1g19850; At1g30330; At5g20730; At5g37020; BIP; CsARF1; CsARF2; CsARF3; F6F9.10; FWF; GSVIVT00014459001; GSVIVT00016396001; GSVIVT00017021001;

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	transcription activator activity	GO:0016563	Molecular Function	-
Sma3	protein dimerization activity	GO:0046983	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	gravitropism	GO:0009630	Biological Process	-
Sma3	phototropism	GO:0009638	Biological Process	-
Sma3	response to ethylene stimulus	GO:0009723	Biological Process	-
Sma3	response to hormone stimulus	GO:0009725	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	blue light signaling pathway	GO:0009785	Biological Process	-
Sma3	flower development	GO:0009908	Biological Process	-
Sma3	longitudinal axis specification	GO:0009942	Biological Process	-
Sma3	leaf vascular tissue pattern formation	GO:0010305	Biological Process	-
Sma3	lateral root primordium development	GO:0010386	Biological Process	-
Sma3	root development	GO:0048364	Biological Process	-
Sma3	leaf development	GO:0048366	Biological Process	-
Sma3	meristem development	GO:0048507	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Aminotransferase, class-II, pyridoxal-phosphate binding site	IPR001917	-	-
Sma3	AUX/IAA protein	IPR003311	-	-
Sma3	B3 DNA binding domain	IPR003340	-	-
Sma3	Auxin response factor	IPR010525	-	-
Sma3	Aux/IAA-ARF-dimerisation	IPR011525	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G37020.1	ARF8, ATARF8 auxin response factor 8 chr5:14630151-14634106 FORWARD LENGTH=811	1.0e-11	81%
RefSeq	Arabidopsis thaliana	NP_001078672.1	auxin response factor 8 [Arabidopsis thaliana]	1.0e-11	81%
RefSeq	Populus trichocarpa	XP_002307574.1	predicted protein, partial [Populus trichocarpa]	6.0e-13	84%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LRW7

Fln msg: Distance to subject end: 539 aas, your sequence is shorter than subject: 32 - 920

Fln protein: ETEESSVRRYMGTIAGISPLDPVRWPKSQWRN

Protein Length: 33

Fln nts: GAAACTGAGGAGTCCAGTGTACGCAGGTATATGGGTACCATTGCAGGAATTAGTCCTCTTGATCCTGTGCGATGGCCAAAGTCACAGTGGCGTAATC

Fln Alignment:

AllPine_a_c60662___ETEESSVRRYMGTIAGISPLDPVRWPKSQWRN
B8LRW7________________ETEDATERRYTGTIVGIGDVDPMRWPNSEWRS

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain