|
||||||
|
UniGene Name: sp_v3.0_unigene124064
Length: 237 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene124064
A |
|
Ace file of the UniGene sp_v3.0_unigene124064
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Pinus nigra RepID=B3U1V3_9CONI | - | - | 2.0e-26 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
| Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g20230; At1g47580; At2g02980; At2g22070; At2g27610; At2g41080; At3g08820; At3g57430; At4g16835; At4g33170; At4g33990; At5g52630; DYW10; EMB2758; F10A12.28; F15K20.29; F16N3.14; F17I5.180; F17O14.29; F4I10.100; F6N7.12; FCAALL.441; GSVIVT00000887001; GS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | thiamine biosynthetic process | GO:0009228 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G47580.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:17485668-17486387 FORWARD LENGTH=239 | 1.0e-29 | 62% |
| RefSeq | Arabidopsis thaliana | NP_175189.2 | putative lipoyltransferase [Arabidopsis thaliana] | 2.0e-29 | 62% |
| RefSeq | Populus trichocarpa | XP_002306231.1 | predicted protein [Populus trichocarpa] | 1.0e-28 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 30 aas, your sequence is shorter than subject: 79 - 370
Fln protein:
N
Protein Length:
80
Fln nts:
A
Fln Alignment:
AllPine_a_c60579___VYTKLESLFWEMKLAGYIPDKSYVLDDVKEEEKEQILNHHSEKLAIAFGLLNTPLGTTLRVIKNLRVCGDCHTAIKFI
A9P0W0________________IYETLETLTLQMKAAGYIPNTNFVLHDVEEEQKEWILGHHSEKLAIAFGIISTPPGTTIRVVKNLRVCGDCHTATKFI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
