SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene124040

Length: 390 nt

UniGene Fasta

>sp_v3.0_unigene124040
ACCGACGACTGTTTGCAGAACGTGGACTTCGATCCCTCGCTGTGGCCAGACAGCAAGTCCCCGAGAAGAGAAAGGAAAGTCCGGGAGGTCCGTGGTAATTTGTTGGTTTATTATCTTTATTCGACCCACCTCGCCTTGACAGTGCAGAAACTATTTGCTGGGCTCTTGACCTTGGTGTTAATGTCAAGATGATTACAGGTGACCAGCTAGCCATTGTGAAAGAGACGGGGCGAAGACTGGGCATGGGTGTGAATATGTACCCATCTTCTTCTTTGCTTGGACATCACAAGGATCCCAATCTTGAAGCAATTCCCGTCGATGAACTGATCGTGAAAGCTGATGGATTTGCCGGAGTATTTCCAGAGCACAAATACGAGATCGTGAAGCGGC

Ace file of the UniGene sp_v3.0_unigene124040

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Autoinhibited H+ ATPase n=9 Tax=rosids RepID=B9ILW8_POPTR	-	-	84%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	81%
Sma3	Plasma membrane H+-ATPase	-	-	-

Source	ECs	Term	Type	e value	Identity
Sma3	Adenosinetriphosphatase.	EC:3.6.1.3	-	3.728e-18	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Purine metabolism	00230		3.728e-18	%
Sma3	Transferred entry: 3.6.3.6.	EC:3.6.1.35	-	5.99e-39	-
Sma3	Proton-exporting ATPase.	EC:3.6.3.6	-	0.0	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Oxidative phosphorylation	00190		0.0	%

Source	Gene names
Sma3	AHA1; AHA10; AHA11; AHA2; AHA3; AHA4; AHA5; AHA6; AHA7; AHA8; AHA9; AT4G30190; ATP1; ATP2; Aa_42640; At1g17260; At1g80660; At2g07560; At2g18960; At2g24520; At3g42640; At3g47950; At3g60330; At4g30190; At5g57350; At5g62670; BHA-1; BHA-2; CHLREDRAFT_38137; C

Source	GOs	Term	Type	Identity
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	hydrogen-exporting ATPase activity, phosphorylative mechanism	GO:0008553	Molecular Function	-
Sma3	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	GO:0015662	Molecular Function	-
Sma3	cellulose synthase (UDP-forming) activity	GO:0016760	Molecular Function	-
Sma3	ATPase activity, uncoupled	GO:0042624	Molecular Function	-
Sma3	ATP biosynthetic process	GO:0006754	Biological Process	-
Sma3	cation transport	GO:0006812	Biological Process	-
Sma3	vacuole organization	GO:0007033	Biological Process	-
Sma3	vacuolar acidification	GO:0007035	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	proanthocyanidin biosynthetic process	GO:0010023	Biological Process	-
Sma3	regulation of stomatal movement	GO:0010119	Biological Process	-
Sma3	proton transport	GO:0015992	Biological Process	-
Sma3	cellulose biosynthetic process	GO:0030244	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, P-type, H+ transporting proton pump	IPR000695	-	-
Sma3	ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter	IPR001757	-	-
Sma3	ATPase, P-type cation-transporter, N-terminal	IPR004014	-	-
Sma3	Cellulose synthase	IPR005150	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Haloacid dehalogenase-like hydrolase	IPR005834	-	-
Sma3	ATPase, P-type, plasma-membrane proton-efflux	IPR006534	-	-
Sma3	ATPase, P-type, ATPase-associated domain	IPR008250	-	-
Sma3	Ribosomal protein S2, conserved site	IPR018130	-	-
Sma3	ATPase, P-type phosphorylation site	IPR018303	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT2G18960.1	AHA1, PMA, OST2, HA1 H(+)-ATPase 1 chr2:8221858-8227268 FORWARD LENGTH=949	82%
RefSeq	Arabidopsis thaliana	NP_194748.1	H(+)-ATPase 2 [Arabidopsis thaliana]	84%
RefSeq	Populus trichocarpa	XP_002325038.1	autoinhibited H+ ATPase [Populus trichocarpa]	84%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LQS1

Fln msg: Distance to subject end: 373 aas, your sequence is shorter than subject: 129 - 955

Fln protein: RRLFAERGLRSLAVARQQVPEKRKESPGGPW*FVGLLSLFDPPRLDSAETICWALDLGVNVKMITGDQLAIVKETGRRLGMGVNMYPSSSLLGHHKDPNLEAIPVDELIVKADGFAGVFPEHKYEIVKR

Protein Length: 130

Fln nts: ACCGACGACTGTTTGCAGAACGTGGACTTCGATCCCTCGCTGTGGCCAGACAGCAAGTCCCCGAGAAGAGAAAGGAAAGTCCGGGAGGTCCGTGGTAATTTGTTGGTTTATTATCTTTATTCGACCCACCTCGCCTTGACAGTGCAGAAACTATTTGCTGGGCTCTTGACCTTGGTGTTAATGTCAAGATGATTACAGGTGACCAGCTAGCCATTGTGAAAGAGACGGGGCGAAGACTGGGCATGGGTGTGAATATGTACCCATCTTCTTCTTTGCTTGGACATCACAAGGATCCCAATCTTGAAGCAATTCCCGTCGATGAACTGATCGTGAAAGCTGATGGATTTGCCGGAGTATTTCCAGAGCACAAATACGAGATCGTGAAGCGGC

Fln Alignment:

AllPine_a_c60549___FAERGLRSLAVARQQVPEKRKESPGGPW*FVGLLSLFDPPRLDSAETICWALDLGVNVKMITGDQLAIVKETGRRLGMGVNMYPSSSLLGHHKDPNLEAIPVDELIVKADGFAGVFPEHKYEIVKR
B8LQS1________________FAERGLRSLAVARQEVPERTKESGGTPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGNDKDASIASLPVDELIEKADGFAGVFPEHKYEIVRR

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain