UniGene Name: sp_v3.0_unigene123890
Length: 244 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene123890
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | protein kinase, putative [Musa balbisiana] | - | - | 1.0e-24 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Sma3 | Putative Receptor-like serine/threonine kinase(RFK1) | - | - | 1.282e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 4.761e-10 | - |
Source | Gene names |
---|---|
Sma3 | 24K23.9; AT1G07650; AT1G53420; AT1G53430; AT1G53440; AT1G56145; A_TM018A10.18; At1g29730; At1g56145; At1g70520; At1g70530; At4g00970; CRK2; CRK3; CRK41; F14G9.24; F1N18.20; F1N18.21; F24B9.29; F24J13.10; F24J13.9; GSVIVT00002759001; GSVIVT00002761001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | metal ion transmembrane transporter activity | GO:0046873 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70530.1 | CRK3 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 chr1:26588750-26591379 REVERSE LENGTH=646 | 2.0e-30 | 61% |
RefSeq | Arabidopsis thaliana | NP_177210.1 | cysteine-rich receptor-like protein kinase 3 [Arabidopsis thaliana] | 2.0e-30 | 61% |
RefSeq | Populus trichocarpa | XP_002314608.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-31 | 61% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLL8
Fln msg: Distance to subject end: 145 aas, your sequence is shorter than subject: 81 - 245
Fln protein:
W
Protein Length:
82
Fln nts:
T
Fln Alignment:
AllPine_a_c60368___WETRFQIITGISRGLAYLHEHSRVPVVHRDIKAANILLDDNLHSKIADFGLAKLFPDDRTHITTNVGGTIGYMAPEYVV
B8LLL8________________WEKRLGIIVGTARGLTYLHEDSNVRIIHRDIKCGNILLDDRFHPKIADFGLARFFPDGETHVSTRVGGTIGYTAPEYAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain