SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene123865

Length: 133 nt

UniGene Fasta

>sp_v3.0_unigene123865
TGCTATAGGATCTGCTCGGGGATTGGCTTATCTGCATGAAGATTGCCATCCTCGAATAATTCACCAGGACATCAAGTCATCCAACATTCTGCTGGATAACAATTTTGAAGCACGGGTCTCAGATTTTGGGCTT

Ace file of the UniGene sp_v3.0_unigene123865

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9T5W9_RICCO	-	-	4.0e-16	88%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	81%
Sma3	Leucine-rich repeat receptor-like protein kinase	-	-	1.16e-15	-

Source	ECs	Term	Type	e value	Identity
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	1.884e-08	-
Sma3		EC:2.7.11.3-	-	6.724e-09	-

Source	Gene names
Sma3	AT1G31420; AT1G55610; AT2G26330; AT2G33170; AT2G35620; AT3G24550; AT4G28650; AT4G39400; AT4g32300; AT4g32710; AT5G07180; AT5G62230; AT5G62710; AT5G63930; At1g26150; At1g49270; At1g55610; At1g68690; At1g70460; At1g78530; At2g18470; At2g26330; At2g33170; At

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to plasma membrane	GO:0005887	Cellular Component	-
Sma3	endosome membrane	GO:0010008	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	protein complex	GO:0043234	Cellular Component	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	structural constituent of cell wall	GO:0005199	Molecular Function	-
Sma3	steroid binding	GO:0005496	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	protein homodimerization activity	GO:0042803	Molecular Function	-
Sma3	protein heterodimerization activity	GO:0046982	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	embryo sac development	GO:0009553	Biological Process	-
Sma3	detection of brassinosteroid stimulus	GO:0009729	Biological Process	-
Sma3	brassinosteroid mediated signaling pathway	GO:0009742	Biological Process	-
Sma3	positive regulation of flower development	GO:0009911	Biological Process	-
Sma3	leaf morphogenesis	GO:0009965	Biological Process	-
Sma3	stomatal complex morphogenesis	GO:0010103	Biological Process	-
Sma3	response to UV-B	GO:0010224	Biological Process	-
Sma3	brassinosteroid homeostasis	GO:0010268	Biological Process	-
Sma3	regulation of cell adhesion	GO:0030155	Biological Process	-
Sma3	ovule development	GO:0048481	Biological Process	-
Sma3	defense response to fungus	GO:0050832	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Bromo adjacent homology (BAH) domain	IPR001025	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Bulb-type lectin domain	IPR001480	-	-
Sma3	C-5 cytosine methyltransferase	IPR001525	-	-
Sma3	Myosin head, motor domain	IPR001609	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Glucose/ribitol dehydrogenase	IPR002347	-	-
Sma3	Dilute	IPR002710	-	-
Sma3	Pistil-specific extensin-like protein	IPR003882	-	-
Sma3	Myosin, N-terminal, SH3-like	IPR004009	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Leucine-rich repeat 2	IPR013101	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	SKG6/AXL2 alpha-helix transmembrane domain	IPR014805	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Homeobox, conserved site	IPR017970	-	-
Sma3	DNA methylase, C-5 cytosine-specific, active site	IPR018117	-	-
Sma3	Dil domain	IPR018444	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G68690.1	Protein kinase superfamily protein chr1:25789192-25791886 FORWARD LENGTH=708	2.0e-20	86%
RefSeq	Arabidopsis thaliana	NP_177036.1	protein kinase-like protein [Arabidopsis thaliana]	2.0e-20	86%
RefSeq	Populus trichocarpa	XP_002315972.1	predicted protein [Populus trichocarpa]	1.0e-21	86%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PRI9

Fln msg: Distance to subject end: 250 aas, your sequence is shorter than subject: 44 - 656

Fln protein: AIGSARGLAYLHEDCHPRIIHQDIKSSNILLDNNFEARVSDFGL

Protein Length: 45

Fln nts: TGCTATAGGATCTGCTCGGGGATTGGCTTATCTGCATGAAGATTGCCATCCTCGAATAATTCACCAGGACATCAAGTCATCCAACATTCTGCTGGATAACAATTTTGAAGCACGGGTCTCAGATTTTGGGCTT

Fln Alignment:

AllPine_a_c60337___AIGSARGLAYLHEDCHPRIIHQDIKSSNILLDNNFEARVSDFGL
C0PRI9________________AIGAARGLAYLHEDCYPKIIHRDIKASNILLDSNFEAKVADFGL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain