|
||||||
|
UniGene Name: sp_v3.0_unigene123803
Length: 241 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene123803
C |
|
Ace file of the UniGene sp_v3.0_unigene123803 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 6.379e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g01510; At2g13600; At2g36730; At3g16610; At3g49170; At4g02750; At5g09950; At5g19020; EMB2261; F13K3.13; F2I9.13; F2K15.30; GSVIVT00000138001; GSVIVT00000621001; GSVIVT00000673001; GSVIVT00000680001; GSVIVT00001706001; GSVIVT00002068001; GSVIVT000024230 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | lipid binding | GO:0008289 | Molecular Function | 0.0 | - |
| Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | lipid transport | GO:0006869 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Sma3 | RNA metabolic process | GO:0016070 | Biological Process | 0.0 | - |
| Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02750.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:1221116-1223461 REVERSE LENGTH=781 | 1.0e-25 | 56% |
| RefSeq | Arabidopsis thaliana | NP_192184.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-25 | 56% |
| RefSeq | Populus trichocarpa | XP_002310520.1 | predicted protein [Populus trichocarpa] | 1.0e-28 | 62% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ0
Fln msg: Distance to subject end: 84 aas, your sequence is shorter than subject: 80 - 644
Fln protein:
L
Protein Length:
81
Fln nts:
C
Fln Alignment:
AllPine_a_c60261___GTKPDEVTFIGVLSACSHAGLVDEGCYYFYSMSKDHHMKPKADHFACMIDLLGRAGCLGEAGDLIDKLPFKPDA
B8LLJ0________________GLKPDRVTFVGVLSACCHAGLVDEGRQYFDIMTRFYHITPAMEHYGCMIDLLGRAGCFDEANDLINKMPIKPDA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
