SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene123682

Length: 209 nt

UniGene Fasta

>sp_v3.0_unigene123682
AATGTCTCTGGTCCAATAGTATTGGTGCACATGAAGGATGGATCATGGCGCATGTGTTCGGATTATAGGGAGCTCAACAAGCTCACTATTAAAGATAAGTTTCCCATTCCTGTGATTGATGAATTATTGGATGAATTGCATGGATCGATTTACTTCACCAAGTTGGATCTTCGTTCAGGATATCATCAAATCAGTAATGAAGAGTGAAG

Ace file of the UniGene sp_v3.0_unigene123682

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Polyprotein n=2 Tax=Primula vulgaris RepID=A5X2S4_9ERIC	-	-	3.0e-21	75%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	54%
Sma3	Retrotransposon protein, putative, unclassified	-	-	6.701e-27	-

Source	Gene names
Sma3	19.t00005; AT4g10580; At2g04670; At2g05610; At2g07660; At2g10780; B1160F02.12; F23H6.1; H0124B04.16; H0211A12.9; H0321H01.8; H0502G05.6; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g06110; LOC_Os03g07050; LOC_Os03g10000; LOC_Os03g13350; LOC_Os03g26020; LOC_Os

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	carbonate dehydratase activity	GO:0004089	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	triglyceride lipase activity	GO:0004806	Molecular Function	-
Sma3	transporter activity	GO:0005215	Molecular Function	-
Sma3	SNAP receptor activity	GO:0005484	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	cysteine-type peptidase activity	GO:0008234	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3		GO:0008415	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	translation	GO:0006412	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	lipid metabolic process	GO:0006629	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	intracellular protein transport	GO:0006886	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	carbon utilization	GO:0015976	Biological Process	-
Sma3	vesicle-mediated transport	GO:0016192	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Ribosomal protein S15	IPR000589	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Target SNARE coiled-coil domain	IPR000727	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Legume lectin, alpha chain, conserved site	IPR000985	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Carbonic anhydrase	IPR001765	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Protein translocase complex, SecE/Sec61-gamma subunit	IPR001901	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Phospholipid/glycerol acyltransferase	IPR002123	-	-
Sma3	Lipase, class 3	IPR002921	-	-
Sma3	Peptidase C48, SUMO/Sentrin/Ubl1	IPR003653	-	-
Sma3	Putative S-adenosyl-L-methionine-dependent methyltransferase	IPR004159	-	-
Sma3	Exostosin-like	IPR004263	-	-
Sma3	Auxin efflux carrier	IPR004776	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Carbamoyl-phosphate synthetase, large subunit, ATP-binding	IPR005479	-	-
Sma3	General substrate transporter	IPR005828	-	-
Sma3	Syntaxin, N-terminal	IPR006011	-	-
Sma3	Syntaxin/epimorphin, conserved site	IPR006012	-	-
Sma3	FBD	IPR006566	-	-
Sma3	Protein of unknown function DUF594	IPR007658	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Peptidase aspartic, catalytic	IPR009007	-	-
Sma3	S15/NS1, RNA-binding	IPR009068	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3		IPR013084	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Concanavalin A-like lectin/glucanase, subgroup	IPR013320	-	-
Sma3	Zinc finger, H2C2-type, histone UAS binding	IPR015416	-	-
Sma3		IPR015706	-	-
Sma3	Carbonic anhydrase, prokaryotic-like, conserved site	IPR015892	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	MULE transposase domain	IPR018289	-	-
Sma3	Peroxidase, active site	IPR019794	-	-

Full-Lengther Next Prediction

Fln status: Complete

Fln database: coniferopsida.fasta

Fln subject: A9NWN2

Fln msg: atg_distance in limit (1-15): atg_distance = 1,

Fln protein: MKDGSWRMCSDYRELNKLTIKDKFPIPVIDELLDELHGSIYFTKLDLRSGYHQISNEE*

Protein Length: 60

Fln nts: AATGTCTCTGGTCCAATAGTATTGGTGCAC_-_ATGAAGGATGGATCATGGCGCATGTGTTCGGATTATAGGGAGCTCAACAAGCTCACTATTAAAGATAAGTTTCCCATTCCTGTGATTGATGAATTATTGGATGAATTGCATGGATCGATTTACTTCACCAAGTTGGATCTTCGTTCAGGATATCATCAAATCAGTAATGAAGAGTGA___AG

Fln Alignment:

AllPine_a_c60118___SGPIVLVHMKDGSWRMCSDYRELNKLTIKDKFPIPVIDELLDELHGSIYFTKLDLRSGYHQI
A9NWN2________________STPIILVRINDGSYILCNNCRVLNEITIKDKFHISIVDELLDELYGTMYFLELDQKSNYYHI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain