|
||||||
|
UniGene Name: sp_v3.0_unigene123572
Length: 217 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene123572
A |
|
Ace file of the UniGene sp_v3.0_unigene123572
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Serine/threonine-protein kinase PBS1, putative n=1 Tax=Ricinus communis RepID=B9RQE1_RICCO | - | - | 1.0e-26 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
| Sma3 | LysM receptor-like kinase | - | - | 1.288e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | CERK1; CM0545.460.nc; GSVIVT00006887001; GSVIVT00009484001; GSVIVT00025924001; GSVIVT00032634001; GSVIVT00034296001; LYK11; LYK6; MBP_91N22.28; NFR1a; Os01g0741200; Os08g0538300; Os09g0511000; OsI_02343; OsI_02346; OsI_03683; OsI_30063; OsI_32002; OsJ_021 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | phosphotransferase activity, for other substituted phosphate groups | GO:0016780 | Molecular Function | 0.0 | - |
| Sma3 | malonyl-CoA decarboxylase activity | GO:0050080 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
| Sma3 | phospholipid biosynthetic process | GO:0008654 | Biological Process | 0.0 | - |
| Sma3 | cell wall macromolecule catabolic process | GO:0016998 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | CDP-alcohol phosphatidyltransferase | IPR000462 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Aliphatic acid kinase, short-chain | IPR000890 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Peptidoglycan-binding Lysin subgroup | IPR002482 | - | 0.0 | - |
| Sma3 | Adenovirus E3 region protein CR2 | IPR003470 | - | 0.0 | - |
| Sma3 | Malonyl-CoA decarboxylase | IPR007956 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | SKG6/AXL2 alpha-helix transmembrane domain | IPR014805 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Peptidoglycan-binding lysin domain | IPR018392 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G51940.1 | protein kinase family protein / peptidoglycan-binding LysM domain-containing protein chr1:19296092-19298941 REVERSE LENGTH=651 | 2.0e-31 | 80% |
| RefSeq | Arabidopsis thaliana | NP_175606.2 | LysM type receptor kinase-like protein [Arabidopsis thaliana] | 3.0e-31 | 80% |
| RefSeq | Populus trichocarpa | XP_002299738.1 | predicted protein [Populus trichocarpa] | 3.0e-32 | 78% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADV0
Fln msg: Distance to subject end: 182 aas, your sequence is shorter than subject: 72 - 271
Fln protein:
M
Protein Length:
73
Fln nts:
A
Fln Alignment:
AllPine_a_c59987___LVELIGYAATEDELFLVYEYAHKSSVSSRLHDPLSKGYTPLSWNARVQIALDAARGLEYIHEHTKTHYVH
D5ADV0________________LVRLIGFC-TEDCLFLAYEFMENGNLSQHLR---GSGMEPLSWPARVQIALEIAKGLEYIHEHTVPAYIH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
