|
||||||
|
UniGene Name: sp_v3.0_unigene123491
Length: 203 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene123491
A |
|
Ace file of the UniGene sp_v3.0_unigene123491
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phytochrome (Fragment) n=2 Tax=Picea abies RepID=Q40757_PICAB | - | - | 3.0e-26 | 98% |
| FL-Next | sp=Phytochrome; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 98% |
| Sma3 | Phytochrome C | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | CpPHY2; GSVIVT00029101001; GmphyA2; OsI_013116; PHY; PHY1; PHY2; PHY3; PHY4; PHY5a; PHYA; PHYB; PHYC; PHYF; PHYP; PHYPADRAFT_185248; PHYPADRAFT_208532; PHYPADRAFT_218861; PHYPADRAFT_225644; PhyC; PhyC-5A; PhyC-5B; PhyC-5D; PhyMpd; phy1; phy2; phy3; phy4; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | G-protein coupled photoreceptor activity | GO:0008020 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | sensory perception | GO:0007600 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | protein-tetrapyrrole linkage | GO:0017006 | Biological Process | 0.0 | - |
| Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
| Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PAS | IPR000014 | - | 0.0 | - |
| Sma3 | PAS-associated, C-terminal | IPR000700 | - | 0.0 | - |
| Sma3 | Phytochrome | IPR001294 | - | 0.0 | - |
| Sma3 | PAC motif | IPR001610 | - | 0.0 | - |
| Sma3 | GAF domain | IPR003018 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain | IPR003661 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, core | IPR005467 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
| Sma3 | Phytochrome A/B/C/D/E | IPR012129 | - | 0.0 | - |
| Sma3 | Phytochrome, central region | IPR013515 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore binding site | IPR013516 | - | 0.0 | - |
| Sma3 | PAS fold-2 | IPR013654 | - | 0.0 | - |
| Sma3 | PAS fold | IPR013767 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore attachment domain | IPR016132 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G09570.1 | PHYA, FHY2, FRE1, HY8 phytochrome A chr1:3095498-3099216 REVERSE LENGTH=1122 | 4.0e-29 | 85% |
| RefSeq | Arabidopsis thaliana | NP_001117256.1 | phytochrome A [Arabidopsis thaliana] | 5.0e-29 | 85% |
| RefSeq | Populus trichocarpa | XP_002318913.1 | phytochrome [Populus trichocarpa] | 3.0e-28 | 82% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q40762
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 826 aas, your sequence is shorter than subject: 67 - 1136
Fln protein:
T
Protein Length:
68
Fln nts:
A
Fln Alignment:
AllPine_a_c59888___TGYDRVMAYRFHEDEHGEVVAEVRRPDLEPYLGLHYPATDIPQASRFLFMKNRVRMI
Q40762________________TGYDRVMAYRFHEDEHGEVVAEMRRPDLEPYLGLHYPATDIPQASRFLFMKNRVRMI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
