UniGene Name: sp_v3.0_unigene122949
Length: 246 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene122949
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Retrotransposon protein, putative, Ty1-copia subclass n=1 Tax=Oryza sativa Japonica Group RepID=Q2QP36_ORYSJ | - | - | 1.0e-28 | 76% |
FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 58% |
Sma3 | Reverse transcriptase-like protein | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA-directed DNA polymerase. | EC:2.7.7.49 | - | 5.602e-11 | - |
Source | Gene names |
---|---|
Sma3 | AT4g04440; AT4g04600; AT4g21360; At2g13930; At2g15700; At2g19840; F28L22.3; F4H6.12; H0306F03.15; H0413E07.4; LOC_Os03g46450; LOC_Os10g01450; LOC_Os10g18420; LOC_Os10g21080; LOC_Os10g34120; LOC_Os11g05840; LOC_Os11g15400; LOC_Os11g17390; LOC_Os12g01780; L |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | phosphopyruvate hydratase complex | GO:0000015 | Cellular Component | 0.0 | - |
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | dihydrofolate reductase activity | GO:0004146 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
Sma3 | phosphopyruvate hydratase activity | GO:0004634 | Molecular Function | 0.0 | - |
Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | nutrient reservoir activity | GO:0045735 | Molecular Function | 0.0 | - |
Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | glycine biosynthetic process | GO:0006545 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | nucleotide biosynthetic process | GO:0009165 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 6.0e-19 | 47% |
RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 8.0e-19 | 47% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 285 aas, your sequence is shorter than subject: 82 - 542
Fln protein:
G
Protein Length:
83
Fln nts:
G
Fln Alignment:
AllPine_a_c59232___LQQLDVKTAFLHGDLDEEIYMEQPEGFVHHRNEKFVCRLKKSLYGLKQSSRQWYKMFDSFMLSQKYVRSEYDHCVYFK
Q9M5J7________________VEQMDVKTTFLHGDLEEEIYMKQPEGFVVKGNKELVCKINKSLCGVKQSPRMWYQKFDTYILRLGFVISRADHCVYSK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain