SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene122949

Length: 246 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene122949
GGTTAGTTGCAGCAGTTAGATGTTAAGACTGCTTTTCTACATGGAGATTTAGATGAGGAAATATATATGGAACAACCGGAAGGGTTTGTTCACCATCGCAATGAGAAATTTGTCTGCAGGCTCAAGAAGTCATTATATGGCCTGAAGCAGTCGTCGCGGCAATGGTATAAGATGTTTGATTCTTTCATGTTGAGTCAGAAATATGTAAGAAGTGAATATGATCATTGTGTTTATTTTAAGCCCCAT

Ace file of the UniGene sp_v3.0_unigene122949 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Retrotransposon protein, putative, Ty1-copia subclass n=1 Tax=Oryza sativa Japonica Group RepID=Q2QP36_ORYSJ	-	-	1.0e-28	76%
FL-Next	tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca).	-	-	0.0	58%
Sma3	Reverse transcriptase-like protein	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	RNA-directed DNA polymerase.	EC:2.7.7.49	-	5.602e-11	-

Source	Gene names
Sma3	AT4g04440; AT4g04600; AT4g21360; At2g13930; At2g15700; At2g19840; F28L22.3; F4H6.12; H0306F03.15; H0413E07.4; LOC_Os03g46450; LOC_Os10g01450; LOC_Os10g18420; LOC_Os10g21080; LOC_Os10g34120; LOC_Os11g05840; LOC_Os11g15400; LOC_Os11g17390; LOC_Os12g01780; L

Source	GOs	Term	Type	Identity
Sma3	phosphopyruvate hydratase complex	GO:0000015	Cellular Component	-
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	intrinsic to membrane	GO:0031224	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	dihydrofolate reductase activity	GO:0004146	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	exonuclease activity	GO:0004527	Molecular Function	-
Sma3	phosphopyruvate hydratase activity	GO:0004634	Molecular Function	-
Sma3	transmembrane signaling receptor activity	GO:0004888	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	manganese ion binding	GO:0030145	Molecular Function	-
Sma3	nutrient reservoir activity	GO:0045735	Molecular Function	-
Sma3	NADP binding	GO:0050661	Molecular Function	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	glycine biosynthetic process	GO:0006545	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	nucleotide biosynthetic process	GO:0009165	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	transposition	GO:0032196	Biological Process	-
Sma3	innate immune response	GO:0045087	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Toll/interleukin-1 receptor homology (TIR) domain	IPR000157	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	ATPase, F0 complex, subunit A	IPR000568	-	-
Sma3	Enolase	IPR000941	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Dihydrofolate reductase domain	IPR001796	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Pleckstrin homology domain	IPR001849	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Germin	IPR001929	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	Putative 5-3 exonuclease	IPR004859	-	-
Sma3	Protein of unknown function DUF295	IPR005174	-	-
Sma3	Cupin 1	IPR006045	-	-
Sma3	Leucine-rich repeat 3	IPR011713	-	-
Sma3	Dihydrofolate reductase	IPR012259	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	RmlC-like jelly roll fold	IPR014710	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3	F-box associated interaction domain	IPR017451	-	-
Sma3	Peptidase A2A, retrovirus RVP subgroup	IPR018061	-	-
Sma3	Germin, manganese binding site	IPR019780	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G23160.1	CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262	6.0e-19	47%
RefSeq	Arabidopsis thaliana	NP_194047.2	cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana]	8.0e-19	47%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q9M5J7

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 285 aas, your sequence is shorter than subject: 82 - 542

Fln protein: G*LQQLDVKTAFLHGDLDEEIYMEQPEGFVHHRNEKFVCRLKKSLYGLKQSSRQWYKMFDSFMLSQKYVRSEYDHCVYFKPH

Protein Length: 83

Fln nts: GGTTAGTTGCAGCAGTTAGATGTTAAGACTGCTTTTCTACATGGAGATTTAGATGAGGAAATATATATGGAACAACCGGAAGGGTTTGTTCACCATCGCAATGAGAAATTTGTCTGCAGGCTCAAGAAGTCATTATATGGCCTGAAGCAGTCGTCGCGGCAATGGTATAAGATGTTTGATTCTTTCATGTTGAGTCAGAAATATGTAAGAAGTGAATATGATCATTGTGTTTATTTTAAGCCCCAT

Fln Alignment:

AllPine_a_c59232___LQQLDVKTAFLHGDLDEEIYMEQPEGFVHHRNEKFVCRLKKSLYGLKQSSRQWYKMFDSFMLSQKYVRSEYDHCVYFK
Q9M5J7________________VEQMDVKTTFLHGDLEEEIYMKQPEGFVVKGNKELVCKINKSLCGVKQSPRMWYQKFDTYILRLGFVISRADHCVYSK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain